KEGG   Klebsiella aerogenes KCTC 2190: EAE_14785Help
Entry
EAE_14785         CDS       T01529                                 

Definition
(RefSeq) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00550  Peptidoglycan biosynthesis
eae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eae00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EAE_14785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eae01002]
    EAE_14785
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eae01011]
    EAE_14785
Enzymes [BR:eae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EAE_14785
Peptidases and inhibitors [BR:eae01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   EAE_14785
Peptidoglycan biosynthesis and degradation proteins [BR:eae01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EAE_14785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 10793179
NCBI-ProteinID: YP_004593149
UniProt: A0A0H3FU96
LinkDB All DBs
Position
3177093..3178295
Genome map
AA seq 400 aa AA seqDB search
MTHDAFSLRGLAAGCALLLLVAPAVQAADQLPDAPSIDARAWILMDYASGKVLSEGNADE
KLDPASLTKIMTSYVVGQALKAGKIKLTDTVTVGRDAWATGNPALRGSSVMFLKPGMQVS
VEDLNKGVIIQSGNDASIAIADYVAGSQDSFVNLMNGYAQKIGLTNTTFKTVHGLDAPGQ
FSTARDMALLTKAMIHDVPEEYAVHKEKEFTFNKIRQPNRNRLLWSTNLNADGVKTGTTA
GAGYNLVSSATQGDMRLIAVVLGTKTDRIRFNESEKLLTWGFRFYETVTPIKPDATFISQ
RVWFGDSNEVKLGAGEAGSVTIPRGQLKNLKASYNLTEPQLTAPLAKGQVVGTIDFKLND
KTIEQRPLIVMEDVKEGGFFSRIVDFVLMKLHGWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatgatgctttttcccttcgcggcctcgcggcaggctgcgcgcttttacttctc
gtggcccctgcagtgcaggcggcggatcaacttccggatgcgccatcgattgatgcgcga
gcctggatcctgatggactatgccagcggcaaagtgctgagtgaaggcaatgccgacgag
aaactcgacccggccagcctgaccaaaatcatgaccagctacgtggtaggccaggcgctg
aaagcaggcaaaatcaaactgaccgatacggtcaccgtcggccgcgatgcgtgggccacc
ggcaacccggcgctgcgcggctcctcggtgatgttcctgaagccaggcatgcaggtatcg
gttgaagacctcaataagggcgtgataattcagtccggcaacgatgccagcatcgccatc
gccgactatgtcgccggcagccaggattcgtttgtcaatctgatgaacggctacgcgcag
aaaatcggcctgaccaacaccacctttaaaaccgtccacggcctggacgcgccggggcag
ttcagtaccgcgcgcgatatggcgctgctgactaaagcgatgatccatgatgtgccggaa
gagtacgcggtacacaaagagaaagagttcaccttcaataaaatccgtcagccaaaccgc
aaccgtctgctgtggagcaccaacctcaatgccgatggcgttaaaaccggcaccaccgcc
ggcgcgggctacaacctggtctcttccgcgacccagggcgatatgcgccttatcgcggta
gtgctgggcactaaaaccgaccgtattcgttttaacgagtccgaaaaactgctgacctgg
ggcttccgtttctatgaaaccgtcacgccaatcaaaccggatgccacctttatttcccag
cgcgtgtggttcggcgacagtaatgaagtcaaactgggcgccggcgaagccggatcggtg
accattccacgcgggcaattgaaaaacctgaaagccagctacaacctgactgagccgcag
ctcaccgcgccgttggcgaaagggcaggtggtgggcaccatcgactttaaactcaatgac
aaaactatcgaacagcgaccgctgatcgtcatggaagacgtgaaagagggcggcttcttc
agccgcattgtcgacttcgtgctgatgaaactgcacggctggttcggcagctggttctct
taa

DBGET integrated database retrieval system