KEGG   Klebsiella aerogenes KCTC 2190: EAE_15910Help
Entry
EAE_15910         CDS       T01529                                 

Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00250  Alanine, aspartate and glutamate metabolism
eae00410  beta-Alanine metabolism
eae00640  Propanoate metabolism
eae00650  Butanoate metabolism
eae01100  Metabolic pathways
eae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EAE_15910
   00650 Butanoate metabolism
    EAE_15910
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAE_15910
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EAE_15910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eae01007]
    EAE_15910
Enzymes [BR:eae01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EAE_15910
Amino acid related enzymes [BR:eae01007]
 Aminotransferase (transaminase)
  Class III
   EAE_15910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 10793403
NCBI-ProteinID: YP_004593372
UniProt: A0A0H3FR33
LinkDB All DBs
Position
complement(3430237..3431502)
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAQNATLTDVEGNEYIDFAAGIAVLNTGHRHPR
MVAAVEQQLQQFTHTAYQIVPYESYVSLAEKLNELAPVKGPAKTAFFSTGAEAVENAVKI
ARAHTGRPGVIAFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVYHVPYPSALHGISTA
DSITALERLFKADIEAKQVAAIIFEPVQGEGGFNVAPKELVAAVRRICDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNAQIMDAPAPGGLGGTYAGN
PLAVAAAHAVLDIIDNEALCERAQFLGERLLATLQEVKGWCPALVEARGVGSMIAAEFFD
PATGEPSAAIAQKIQQQALEQGLLLLTCGQYGNVIRFLYPLTIPDAQFSRALTILQSVTR
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttccgctaccccgcgcggcgtgggcgtt
atgtgcaacttctttgcccagagcgcgcaaaacgccacgttgaccgatgtcgagggcaat
gaatatatcgatttcgccgccggtatcgcggtgctgaataccggccatcgccatccgcgg
atggtcgccgcggttgaacagcagctacagcaatttacccataccgcctatcagatcgtg
ccttatgaaagctatgtgtcgctggcggagaagctcaacgaactggcgccggtcaaaggc
ccggcaaaaaccgccttcttctctaccggtgcggaagcggtagaaaacgcggtgaaaatc
gcccgtgcccataccggacgccccggcgttatcgccttcggcggcggtttccatggccgt
acctatatgacgatggcgctaaccggtaaggtcgcgccgtacaaactgggcttcgggccg
ttccccggctcggtataccacgtgccgtacccgtcagcgctgcacggtatcagcaccgcc
gattcgattaccgcccttgaacgcctgttcaaagccgatatcgaagccaaacaggtggca
gcgattattttcgaaccggtacagggcgaaggcggctttaacgttgcgccgaaagagctg
gttgccgcggtacgccgcatctgcgatgagcacggcatcgtgatgattgccgatgaagtg
cagagcggcttcgcccgcaccggcaaattgttcgccatggatcactatgccgataaaccg
gatctgatgacgatggctaaaagcctggcgggcggcatgccgctttccggcgtggttggt
aacgcgcagattatggatgccccggcgccgggcggcttaggcggcacctacgccggcaac
ccgctggcggtggcggccgcgcatgcggtgctggatatcattgataacgaagcgctgtgc
gagcgcgcgcagttcctcggcgagcgcctgctggcaacgctacaggaagttaagggctgg
tgtcctgcgctggtggaagcgcgcggcgtgggttcgatgatcgccgccgagttcttcgat
ccggcgaccggcgaaccttcggcggcgattgcgcagaaaatccagcagcaggcgctggag
cagggcctgctgctgttgacctgcggtcagtatggcaacgtcattcgcttcctctatccg
ttgaccatcccggatgctcaattctcccgcgcgctgacgattctgcaaagcgtcactcgt
ctgtaa

DBGET integrated database retrieval system