KEGG   Klebsiella aerogenes KCTC 2190: EAE_18425Help
Entry
EAE_18425         CDS       T01529                                 

Definition
(RefSeq) putative dehydrogenase
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00040  Pentose and glucuronate interconversions
eae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAE_18425
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     EAE_18425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP TrkA_N NADH_4Fe-4S
Motif
Other DBs
NCBI-GeneID: 10793909
NCBI-ProteinID: YP_004593871
UniProt: A0A0H3FW97
LinkDB All DBs
Position
3969891..3970910
Genome map
AA seq 339 aa AA seqDB search
MKSIVIQQPNALAIEERPLPQPGNGEVRVKVKLAGICGSDSHIYRGHNPFAKYPRVIGHE
FFGVIDAVGEGVTDKVVGQRVTVDPVISCGHCYPCSVGKPNVCASLVVLGVHRDGGFSEY
AVVPAKNAWPVPENVSDHHAVMVEPFTIAANVTGQAKPREQDIALVYGAGPMGLTTIQVL
KRVYNVRQVIVADQIPERLQMAQQNGADLTINNKEQPLAQALEAQGIRPTLIIDAACHPA
IFAEAIALASPAGRIVLMGFSTEPSMVAQQGITGKELTIYSSRLNANKFPLVLEWLANGL
INPERLITHQFAFEDVVDAMTLFEEDRKHCCKVLLTFNA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattgttatccaacagccaaacgcgctggcgattgaagaacggccgctgccg
cagccgggaaatggagaagtgcgggtaaaggtgaaactggcgggaatttgcggctcagat
agccacatctatcgtggacataacccgttcgccaaatatccccgggtcatcggccacgag
tttttcggcgtgattgatgccgtgggcgagggggtgacggataaagtcgtgggccagcgg
gtgacggttgatccggttatcagctgcggccactgttatccctgttcggtcggtaagccc
aacgtctgcgcttcgctggtggtgctgggcgtccatcgcgatggcggttttagcgaatac
gcggtggtaccggccaaaaatgcctggccggtgccggagaacgtgagcgaccatcatgcg
gtaatggttgagccctttaccattgcggcgaatgtcaccgggcaggctaaaccacgcgaa
caggatatcgcgctggtctacggtgctgggccgatggggctgaccaccattcaggtgctc
aagcgcgtctataacgtgcggcaggtcatcgttgccgatcagatccccgagcggctgcag
atggcgcagcaaaacggcgccgacttgaccatcaataataaggaacagccgctggcgcag
gcgctggaagcgcagggtatccggccgacgctgattatcgacgccgcctgccatccggcg
attttcgcagaggccatcgcactggcctcgccggcgggcaggatcgtattgatgggcttt
tctaccgaaccttcaatggtggcgcagcaggggatcaccggcaaagagctcactatttat
tcttccagactcaatgccaataaattcccgctggttcttgaatggttggcaaacggatta
ataaatccggagcggctcatcacccatcagtttgcctttgaggatgttgtcgatgccatg
acgttatttgaagaagatcgcaagcattgttgtaaggtgttattaaccttcaacgcataa

DBGET integrated database retrieval system