KEGG   Klebsiella aerogenes KCTC 2190: EAE_22000
Entry
EAE_22000         CDS       T01529                                 

Definition
(RefSeq) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
KEGG Orthology (KO) [BR:eae00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eae02044]
    EAE_22000
Secretion system [BR:eae02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAE_22000
SSDB
Motif
Pfam: T6SS_VasE Transposase_mut Glutaredoxin2_C
Other DBs
NCBI-GeneID: 10794616
NCBI-ProteinID: YP_004594578
UniProt: A0A0H3G2A2
LinkDB
Position
complement(4708651..4709994)
AA seq 447 aa
MKTLRPLWGRGQMISPQHFQQQVNQAAWQSECIARLGVMNPWGIIRVEFDAALLKQGTLK
ASHLYVRFPDGTLIDSDNADALPEVMVLPQAESRELTVVLALPHEHENGGNCLQMEQRAE
RPVRWRLAWREVRNRYGEDSRQIAVMLAQLTLRTADDNNGDYQTVAVARLRRDSQDCWSL
DENFIPPLLKVLASRWLHEQTEQLTNQLGVRLQRLMAMRRESNARMADFAVADVSLFWLL
NALNSAEPVLNHFLRHPQVHPERLYEALASLAGSLLTFSLDHTTADIPPYRHQALTEVFP
PLFKLLGVLLEASLPSRVVAIEMTHDDRRKRWHARLHDPRLREEADFYLSVRSALPAAQL
LEQLPQQCKAGSPDEVDRVVNGSQPGIPLKAMSHVPAAIPLRLENQYFTLDMTHPAAQAM
LAEGSCVFYVPGLLGDPELELYAVLRS
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgaagacattacgaccactgtggggcaggggtcagatgatctccccacaacattttcaa
cagcaggtgaaccaggcggcctggcaaagcgaatgtatcgcccgtctgggggtgatgaat
ccctgggggatcatccgcgtcgaatttgacgccgcattgctaaaacaggggacgctgaag
gccagccacctctatgtacgcttccctgatggaacgcttatcgacagcgataacgctgat
gcgttgcctgaggtcatggtgttgccgcaagcggaaagccgcgaattaacggtggtgctg
gcgctgcctcatgagcatgaaaacggcggcaactgcctgcagatggaacaacgcgcagag
cggccggtacgttggcgtttggcctggcgagaagtacgcaacagatatggcgaagacagt
cgacaaattgcggtgatgcttgcgcaactgacgctgcgcacagcggatgacaataacggc
gattatcaaaccgtcgccgtcgccagattacgtcgcgacagtcaggattgctggtcgttg
gatgagaactttatcccaccgctgctgaaagtgttggccagccgctggctgcacgaacaa
acggaacagctgacgaatcaactgggcgtgcgcctgcaacgcctgatggccatgcgtagg
gaaagcaacgccaggatggcggattttgcggtagcggatgtatcgctgttttggctgctg
aacgcgcttaacagcgcggagccggtgttgaaccatttcctgcgccatccgcaggtacat
ccggaacggctgtatgaagcgctggccagcctggcgggcagcctgttgaccttctccctt
gaccataccacggcggatattccgccctatcgccatcaggcgttgacggaagtctttcca
ccgctgttcaaattactcggcgtactgctcgaagccagcctgccatcccgggttgtggcg
attgaaatgacgcacgatgaccggcgtaagcgctggcatgcccgtctgcacgatccaagg
ttgcgcgaagaggccgatttttatctctcggtgcgttccgcgctacctgcggcgcaactg
ctggagcagttaccgcaacagtgtaaagccggtagccccgatgaggttgaccgggtggtc
aacggttcgcagcccggcattccgctgaaagccatgagtcatgttcccgccgccatcccg
ctgcgcctggagaatcagtatttcacccttgatatgactcatccggcggcgcaggcgatg
ctggcggaagggagttgcgtcttttacgtgcccggcctgctgggcgacccggaactcgaa
ctctacgcggtgctgcgctcatga

DBGET integrated database retrieval system