KEGG   Klebsiella aerogenes KCTC 2190: EAE_24495Help
Entry
EAE_24495         CDS       T01529                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
KEGG Orthology (KO) [BR:eae00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EAE_24495
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     EAE_24495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 10795118
NCBI-ProteinID: YP_004595071
UniProt: A0A0H3FZH7
LinkDB All DBs
Position
5223518..5224147
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAQLAYRLIHVDIGKGEQFRPQFLAISPNNKIPAIVDHVP
VDGGAPLSLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVGGLGPMLGQNHHFNH
HAPQAVPYAIERYQVESQRLYGVMNRRLETSPWLGGEHYSIADIACWPWVNAYPRQRIDL
SQFPAVHNWFERIRQRPATQQALLKTQHY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctttactacgcacctacccccaacggccacaaaatcactctttttctcgaa
gaggcgcagctggcctatcgcctgatacacgtcgatatcggcaaaggtgaacagtttcgc
ccgcagtttctggctatctcgccaaataataagatcccggcgatcgttgaccacgttccg
gtcgacggcggcgcgccgttaagcctgtttgagtcaggagagatcctgctctatctggcg
gagaaatcgggaaaattactaagcggcgagctgcgcgagcggcatactaccctgcaatgg
ctattctggcaggtcggcggtctggggccaatgcttgggcaaaaccaccactttaaccat
cacgcgcctcaggctgtcccttacgccattgaacgctatcaggtcgaaagccagcgcctg
tatggcgtaatgaaccggcgtcttgaaaccagtccatggttgggcggcgagcactacagt
atcgccgatatcgcctgttggccatgggttaatgcctacccgcgccaacgcatcgatctt
agccagttcccggcggtgcataactggtttgaacgcatccgccagcgcccggcaacgcaa
caagcgctactcaaaacgcaacattattaa

DBGET integrated database retrieval system