KEGG   Ensifer adhaerens Casida A: FA04_04140Help
Entry
FA04_04140        CDS       T04507                                 

Definition
(GenBank) aminomethyltransferase
  KO
K06980  tRNA-modifying protein YgfZ
Organism
eah  Ensifer adhaerens Casida A
Brite
KEGG Orthology (KO) [BR:eah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eah03016]
    FA04_04140
Transfer RNA biogenesis [BR:eah03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    FA04_04140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T
Motif
Other DBs
NCBI-ProteinID: ANK71892
LinkDB All DBs
Position
complement(878206..879054)
Genome map
AA seq 282 aa AA seqDB search
MPRVRLDDRAIVSISGKDAEDLLQGLITTDLDALAPDEARPGALLTPQGKILFEFLISRD
GDGLRLETASDQAEALLKRMTMYKLRSAVELSIRTSDAVTVIFDEAEPTGAYRDHRFEKA
GVALFRAYGEATGDTAGAEDLERLRIAAGIANAGADYAVQDAFPHDVLLDKNGGLSFKKG
CYVGQEVVSRMQHRSTPRRRVVIVSADAALPPTGTTITANDKAIGALGTVQGKSALAIVR
IDKAGEAMANGIPLLAGDVPVTMVLPEWTGLTFPTSTDEASA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcccagagttcgcctcgacgatcgtgcgatcgtctccatttccggcaaggacgccgaa
gatcttcttcagggactgatcaccaccgacctcgacgcgcttgcacccgacgaggcgcgt
cctggcgcgcttctgacgccacagggcaagatcctgttcgagttcctgatctcccgcgac
ggcgatggcctgcggctggaaacggcaagcgaccaggccgaagcgctgctgaagcgcatg
acgatgtacaagcttcgctcggcagtcgagctttcgatcaggacttccgacgccgtcacc
gtgatattcgacgaagcagaaccgacgggtgcctatcgggaccaccgtttcgagaaggcg
ggcgttgcgctctttcgcgcctatggggaagccaccggcgacacggccggcgcagaagac
ctcgaacggctgcggatcgcggcgggcattgcgaatgccggtgccgattatgcggtgcag
gacgcattcccccatgacgtgctcctggacaaaaacggcggcctctccttcaagaagggc
tgctacgtcggtcaggaagtggtgtcgcgcatgcagcaccgcagcacgccgcgccgccgg
gtcgtgatcgtttcggcggacgccgcccttcctcccacgggaacgacgattacggcgaac
gacaaggcgatcggcgcgctgggcacggtgcagggcaagtcggcgctcgcgatcgtgcgc
atcgacaaggccggtgaagccatggcgaatgggatcccgctgctcgccggcgacgtgccg
gtgacaatggttctgcccgaatggaccggcctcaccttcccgaccagcacggacgaggca
agcgcgtga

DBGET integrated database retrieval system