KEGG   Ensifer adhaerens Casida A: FA04_05410Help
Entry
FA04_05410        CDS       T04507                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
eah  Ensifer adhaerens Casida A
Brite
KEGG Orthology (KO) [BR:eah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:eah03012]
    FA04_05410
   03029 Mitochondrial biogenesis [BR:eah03029]
    FA04_05410
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eah04147]
    FA04_05410
Translation factors [BR:eah03012]
 Eukaryotic Type
  Elongation factors
   FA04_05410
 Prokaryotic Type
   FA04_05410
Mitochondrial biogenesis [BR:eah03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    FA04_05410
Exosome [BR:eah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   FA04_05410
  Exosomal proteins of breast cancer cells
   FA04_05410
  Exosomal proteins of colorectal cancer cells
   FA04_05410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ANK72109
LinkDB All DBs
Position
1142679..1143854
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRDTSKTTVTGVEMFRKLLDQGQAGDNIGALIRGVNRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVAVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgagcgcaacaagccgcacgttaacattggcacgattggccac
gttgaccatggcaagacgtcgctgaccgcagcgatcacgaagtacttcggcgagttcaag
gcgtacgaccagatcgacgctgctccggaagaaaaggcccgtggtatcacgatttcgacg
gcgcacgttgagtatgagacgccgaaccgtcactacgctcacgttgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcagcgcagatggacggcgcgatcctggtt
tgctcggctgctgacggcccgatgccgcagacccgcgagcacatcctgctcgctcgtcag
gttggcgttccggcaatcgtcgtgttcctcaacaaggtcgaccaggttgacgacgccgag
cttctcgagctcgtcgagctggaagttcgcgaacttctgtcgtcctacgaattcccgggc
gacgacattccgatcatcaagggctcggctcttgctgctctggaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggcagctgttgacgcctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgtggtacggttgtgaccggtcgcgttgagcgcggcatcgtcaaggtcggcgaagaagtc
gaaatcgtcggcatccgcgacacgtcgaagacgacggttacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggctggcgacaacatcggcgcgctgatccgtggtgttaac
cgtgacggcgttgagcgtggccagatcctgtgcaagccgggttcggtcaagccgcacaag
aagttcatggctgaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgacgggcatcgtgacg
ctgccggaaggcacggaaatggttatgccgggcgacaacgtcaccgttgccgttgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgcaatccgcgaaggcggccgtacc
gtcggcgcaggcatcgttgcctcgatcgtcgagtaa

DBGET integrated database retrieval system