KEGG   Ensifer adhaerens Casida A: FA04_08075Help
Entry
FA04_08075        CDS       T04507                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eah01100  Metabolic pathways
eah01110  Biosynthesis of secondary metabolites
eah01130  Biosynthesis of antibiotics
eah01230  Biosynthesis of amino acids
eah02024  Quorum sensing
Module
eah_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FA04_08075
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FA04_08075
Enzymes [BR:eah01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     FA04_08075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-ProteinID: ANK74771
UniProt: A0A2V4X1L8
LinkDB All DBs
Position
complement(1695861..1697234)
Genome map
AA seq 457 aa AA seqDB search
MAQTWTPNSWRQKPIQQVPEYPDLAALEATEARLAKYPPLVFAGEARRLKSALANVAEGR
GFLLQGGDCAESFAEHGADTIRDFFRAFLQMAVVLTFGAQQPVVKVGRIAGQFAKPRSSG
IEKQGDVTLPSYRGDIINGIEFTEEARIPNPERQIMAYRQSAATLNLLRAFAMGGYANLD
NVHQWMLGFVKDSPQAERYRKLADRISETMDFMKAIGITSENHPSLRETDFFTSHEALLL
GYEQALTRVDSTSGDWYATSGHMIWIGDRTRQPDHAHIEYCRGIKNPLGLKCGPSLTADG
LLELIDLLNPANEAGRLTLICRFGHDKVAEHLPRLIRAVEREGKKVVWSCDPMHGNTITL
NNYKTRPFERILSEVESFFQIHRAEGSHPGGIHIEMTGNDVTECTGGARALSGDDLADRY
HTHCDPRLNADQALELAFLLAERMKGGRDEKKMVVNG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacttggactccaaacagctggcggcagaaacccatccagcaggtgccggaa
tatccggacctggcagcgcttgaggcgaccgaagcgcgcctcgcgaagtatccgccgctg
gtgtttgcgggcgaagcccgtcgtctgaagagtgccctcgccaatgtcgccgaaggccgc
ggcttcctgctgcagggcggcgactgcgccgagagctttgccgagcacggcgctgacacg
atccgcgactttttccgcgccttcctgcagatggccgtcgttctgacgttcggtgcacag
cagccggtggtcaaggtcggccgtatcgccggccagttcgccaagccccgctcctcgggt
atcgagaagcagggtgacgtgacgcttccgtcctaccgcggcgacatcatcaacggcatc
gagttcaccgaggaagcgcgcattccgaacccggagcgccagatcatggcttaccgccag
tcggctgcgacgctgaaccttctgcgcgcgtttgcgatgggcggctatgccaacctcgac
aacgtgcaccagtggatgctcggcttcgtcaaggacagcccgcaggcggaacgctaccgc
aagcttgcggaccgcatctccgagaccatggacttcatgaaggcgatcggcatcacctcg
gaaaaccacccgagcctgcgcgagaccgatttcttcaccagccacgaggcgctgctgctc
ggctacgagcaggcgttgacgcgcgtcgactcgacctcgggcgactggtacgccacgtcc
ggccacatgatctggatcggcgaccgtacccgccagcctgaccatgcgcatatcgaatac
tgccgcggcatcaagaacccgctcggcctcaagtgcggtccgtcgctgacggccgatggc
ctgctggagctgatcgaccttctgaacccggccaacgaagccggccgcctgacgctcatc
tgccgtttcggccatgacaaggtggccgagcatctgccgcgcctcatccgtgcggtcgag
cgcgaaggcaagaaggtggtctggtcctgcgacccgatgcacggcaacacgatcacgctc
aacaactacaagacccgtccgttcgagcggatcctgtcggaagtggagagcttcttccag
atccaccgcgccgagggttcgcacccgggcggcatccatatcgagatgaccggcaacgac
gtgacggaatgcaccggcggtgcgcgtgcgctttcgggcgacgatctcgccgaccgttac
cacacccattgcgatccgcgcctcaacgcggaccaggcgctggaactcgccttcctgctc
gccgaacgcatgaagggcggccgcgacgagaagaagatggtcgtcaacggctga

DBGET integrated database retrieval system