KEGG   Ensifer adhaerens Casida A: FA04_12020Help
Entry
FA04_12020        CDS       T04507                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00010  Glycolysis / Gluconeogenesis
eah00620  Pyruvate metabolism
eah01100  Metabolic pathways
eah01110  Biosynthesis of secondary metabolites
eah01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FA04_12020
   00620 Pyruvate metabolism
    FA04_12020
Enzymes [BR:eah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     FA04_12020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ANK73282
LinkDB All DBs
Position
complement(2481451..2482959)
Genome map
AA seq 502 aa AA seqDB search
MLHQKIVESPFKQKYGNFIGGEWREPVAGRYFDNTTPVTGGVLCQVARSDAADIELALDA
AHAVREKWGRTSAAERSNILMKIAGRMEDNLELLARAETFDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNC
VVLKPAEQTPASILVWAELIGDLLPAGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVLAEDDDYFDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMERAVKRVEAIRQGNPLDSATMIGAQASSEQLEKILSYIDIGKQEGA
EVLTGGGRNVLEGELSEGFYVKPTVFRGHNKMRVFQEEIFGPVVSVTTFKTEAEALEIAN
DTLYGLGAGVWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttgcatcagaagatcgtcgaaagcccgttcaaacagaaatacggcaacttcatcggt
ggcgaatggcgcgagccggtggccggccgctacttcgacaatacgacgccggtgaccggc
ggtgtgctttgccaggtggcgcgctcggatgccgccgatatcgagctggcgctcgatgct
gcccatgccgtccgcgagaaatggggccgcacctcggccgctgagcgttccaacatcctg
atgaagatcgccggccggatggaggacaatctcgaactgctggcgcgggccgagaccttc
gacaacggcaaaccgatccgcgagaccatggccgccgacattccgcttgccatcgaccat
ttccgctacttcgccgcctgcatccgcgcccaggaaggttcgatcggcgagattgaccat
gacacggtcgcctatcacttccacgagccgctcggcgtcgtcggtcagatcatcccctgg
aacttcccgatcctgatggccgcctggaagctggcgccggcacttgcggccggcaactgc
gtcgtgctgaaaccggccgagcagacaccggcgtcgatcctcgtctgggcggaactgatc
ggcgatctccttccggccggcgtgctcaacatcgtcaatggtttcggtctcgaagccggc
aagccgctcgccaccagcccgcgcatcgccaagatcgcctttaccggcgagacgacgacc
gggcggctgatcatgcaatatgccagccagaaccttattccggtgacgctggagctcggc
ggcaagtcgccgaacatcttcttcgccgatgtgctcgccgaagacgacgactacttcgac
aaggcgctcgaaggctttgccatgttcgcgctgaaccagggtgaggtctgcacctgcccg
agccgcgcactggtgcaggagagcatctatgaccgcttcatggaacgggcggtaaaacgc
gtcgaggcgatccgccagggcaatccgctcgacagcgccacgatgatcggcgcgcaggcg
tcgagcgaacagctcgaaaagatcctctcctacatcgatatcggcaaacaggaaggcgcc
gaggtgctgaccggcggcggccgcaatgtgctcgaaggcgagctgtcggaaggcttctac
gtcaagccgaccgttttccgcgggcataacaagatgcgcgtgttccaggaggagatcttc
gggcctgtcgtttcggtcaccaccttcaagaccgaggccgaagcgctggagatcgccaac
gacacgctctatggcctcggggccggtgtgtggagccgcgatgccaaccgctgctaccgc
ttcggccgcgagatccaggccgggcgtgtgtggaccaattgctatcacgcctatccggcg
catgcggccttcggcggctacaagcagtccggcatcggccgcgagacgcacaagatgatg
ctcgatcactaccagcagaccaagaacatgctggtgagctacagccccaaggcgctcggc
ttcttctga

DBGET integrated database retrieval system