KEGG   Ensifer adhaerens Casida A: FA04_12305Help
Entry
FA04_12305        CDS       T04507                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00240  Pyrimidine metabolism
eah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FA04_12305
Enzymes [BR:eah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FA04_12305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ANK73334
LinkDB All DBs
Position
complement(2541679..2542266)
Genome map
AA seq 195 aa AA seqDB search
MAKLYFSYATMNAGKSTMLLQASYNYQERGMRVVMLIAAHDDRGGVGRISSRIGLGADAI
PFHGDDDLYGLIDRLHSDGEGEIACIFVDEAQFLNEGQVWQLARVADRIGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICHCGRKATMVVRLDGEGKVAREGAQVEVGGNEKY
VSYCRRHWDDLMRCE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaaactctatttcagctatgcgacgatgaatgcgggcaagagcacgatgctcctg
caagcctcctacaactaccaggagcgcggcatgcgcgtggtgatgctgatcgccgcccat
gacgaccggggcggcgtcggccgcatttcctcccgcattggtcttggtgcggacgccatt
ccctttcacggcgacgacgatctctatgggctgatcgatcggttgcactcggatggcgaa
ggcgagatcgcctgcatcttcgtcgacgaggcgcagttcctcaatgaggggcaggtctgg
cagctcgcccgcgtcgccgaccgcatcggcattccggtcatggcctatggtctgcgtacg
gatttccagggcaagctgtttccgggctcgatggcgctgctggcgattgccgacgagctg
cgcgaagtgcgcaccatctgccattgcggccgcaaggcgacgatggtcgtgcgcctggac
ggtgagggcaaggtcgcgcgcgagggcgcccaggtcgaggttggcggcaacgagaaatat
gtctcctattgccggcgccattgggacgacctgatgcgctgcgagtga

DBGET integrated database retrieval system