KEGG   Ensifer adhaerens Casida A: FA04_16360Help
Entry
FA04_16360        CDS       T04507                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00564  Glycerophospholipid metabolism
eah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FA04_16360
Enzymes [BR:eah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     FA04_16360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 FAD_binding_3 STPPase_N
Motif
Other DBs
NCBI-ProteinID: ANK74052
LinkDB All DBs
Position
3368406..3369923
Genome map
AA seq 505 aa AA seqDB search
MSEQAIYDVFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPYHKGGLRPAWLIRLGLFLYDHIGGRKL
LPATATLDMNRDPAGKPLKRLFNKAFEYSDGWVNDARLVVLNARDAADRGAVIMARTRVV
AARRDGGLWAIETENQATGERKTLKARMLINAAGPWVDAVLSGALGKNDVHNVRLVQGSH
IVVKKKFDDPRAYFFQNPDGRIMFAIPYEEDFTLIGTTDRDYTGNPGEVRISDAEVDYLC
RAASEYFLEPVEKDDIVWTYSAVRPLYDDGASKAQEATRDYVLRVEGDKGAAPLLNVFGG
KLTTYRRLGESALEKIGEAIGVKGSKWTAGSRLPGGDFPAQGYADEVARLRKQYPFLAPQ
HARRLVRLYGTRAAALLGSASNEAGLGHHFGADLYEAEVKWLMTQEWARHAEDVLWRRTK
LGLKLTPGEAAALEEYMRGAANAAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcaggcaatctacgacgtcttcgtcatcggcggcggcatcaacggatgcggc
atcgcgcgcgacgcggtcggccgtgggtactcggtcgccttggccgaaatgaacgatttc
gcttccggcacgtcctccggctccaccaagctcattcacggcggcctgcgctacctcgaa
cattacgaattccgcctcgtgcgcgaagcgctgatggagcgcgaggtgctgtgggcaatg
gcgccgcacgtcatctggccgatgcgcttcgtgctgccctatcacaagggcggcctgcgc
ccggcctggctcatccgcctcggcctcttcctttatgaccatatcggcggccgcaagctg
ctgccggcaacggcgacgctggacatgaaccgcgatcccgccggcaaaccgctgaagcgc
ctgttcaacaaggccttcgaatattccgacggctgggtcaacgacgcccgcctcgtggtc
ttgaatgcccgcgacgctgccgaccgcggcgccgtcatcatggcccgtacccgcgtcgtc
gctgcacgtcgcgacggtgggctctgggccatcgaaaccgagaaccaggcaaccggcgaa
cgcaagacgctcaaggcccgcatgctcatcaatgccgccggcccctgggtcgacgcggtt
ctctcgggcgcgctcggcaagaacgacgtgcacaatgtccgcctcgttcagggcagccac
atcgtcgtgaagaagaagttcgacgatccgcgcgcctatttcttccagaacccggatggc
cgcatcatgttcgccatcccttacgaagaagacttcacgctgatcggtaccaccgaccgc
gactacaccggtaatccgggcgaggtgcgcatcagcgacgcggaggtcgactatctctgc
cgggcagcaagcgagtatttccttgagccggtggaaaaggacgacatcgtctggacctat
tcggccgttcgcccgctttacgacgacggcgccagcaaggcgcaggaagcgacgcgcgac
tacgtgctgcgggtcgagggtgacaagggtgcggcaccactgctcaacgtcttcggcggc
aagctcacgacctatcgccgcctcggcgaatccgcgctggaaaagatcggcgaggcgatc
ggcgtcaagggttcgaaatggaccgccggctccaggcttccgggcggcgattttcccgcc
cagggttatgccgacgaagtcgcaagactgcgaaagcaatatcccttccttgcgccccag
catgcgcgtcgcctcgtgcgcctctatggcacgcgcgccgcagcacttctgggttcggcg
tcgaacgaggccggtctcggccaccatttcggcgccgatctctacgaggccgaggtcaag
tggctgatgacgcaggaatgggcgcggcacgccgaggacgtgctgtggcggcgcacgaaa
ttgggattgaagctgacgccgggcgaggcggcagcgctggaggaatacatgcgaggcgcg
gccaacgcagccgcctga

DBGET integrated database retrieval system