KEGG   Ensifer adhaerens Casida A: FA04_27260Help
Entry
FA04_27260        CDS       T04507                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
eah  Ensifer adhaerens Casida A
Brite
KEGG Orthology (KO) [BR:eah00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    FA04_27260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE DUF3169
Motif
Other DBs
NCBI-ProteinID: ANK76293
UniProt: A0A4S2U457
LinkDB All DBs
Position
pCasidaAA:1682251..1683012
Genome map
AA seq 253 aa AA seqDB search
MLLAIGSGSLTGFTLGLIGGGGSILATPLLIYVVGIRDVHTALGTGALAVSANAYLNLIS
HALRGHLWWRCALIFTVAGSLGAFFGSSLGKLIDGQRLLFLFGLVMMFVSFAMRKVRCDT
AATPQSLSLGTHGKTGLTALLTGTCSGFFGIGGGFLIVPGLLLATGMPLINAVGTSLLAV
GTFGLTTAINYAASGLVDWRIAGYFILGGVAGGVIGTIVSTQLSTQRDTLTKIFRAIIFS
VSLYVLWRSYGAV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgcgatcggctccggttcgctcaccggcttcacgctcggcctgatcggcggt
ggcggctcgatcctggcgacgccgctcctgatctatgtcgtcggcatccgcgacgtgcac
accgcgctcggcaccggagcgcttgcggtttccgccaatgcctatctcaacctgataagc
cacgcgctccgcggtcatctctggtggcgctgcgcgctgatcttcacggtcgcgggttcg
cttggcgcctttttcggctccagcctcggcaagctgatcgatggccagcgattgctgttc
ctcttcggcctcgtgatgatgttcgtcagcttcgccatgcggaaggtcaggtgcgacacg
gcggcgacaccgcagtcgctttcgctcggcacacacggcaagaccggcttgacagcgctt
ctgaccggcacctgttccggcttcttcggcatcggcggcggtttcctcatcgttcccgga
ctgctgcttgcgaccggcatgccgctcatcaacgctgtgggcacgtcgctgcttgctgtc
ggcaccttcggcctgacgaccgcgatcaactatgccgcctctggattggtggattggcgc
atcgccggctacttcatcctgggtggcgtcgcgggtggcgtgatcggcacgatcgtttcg
acgcagctttcgacccagcgcgatacgctgaccaagattttccgtgcgatcatcttttcc
gtcagcctttacgttctctggcgcagctacggagccgtgtga

DBGET integrated database retrieval system