KEGG   Ensifer adhaerens Casida A: FA04_32260Help
Entry
FA04_32260        CDS       T04507                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
eah  Ensifer adhaerens Casida A
Pathway
eah00330  Arginine and proline metabolism
eah00360  Phenylalanine metabolism
eah00380  Tryptophan metabolism
eah00627  Aminobenzoate degradation
eah00643  Styrene degradation
eah01100  Metabolic pathways
eah01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    FA04_32260
   00360 Phenylalanine metabolism
    FA04_32260
   00380 Tryptophan metabolism
    FA04_32260
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    FA04_32260
   00643 Styrene degradation
    FA04_32260
Enzymes [BR:eah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     FA04_32260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ANK77322
LinkDB All DBs
Position
pCasidaAB:complement(1037508..1038917)
Genome map
AA seq 469 aa AA seqDB search
MTIVSDDFTLLSLTEIGDRIKRGSISSLAITEAQLRRIARLEPDLHAYAQVMDASALEQA
KVADEEIAAGRHRGPLHGVPIAVKDLCWIEGVPTRAGTLVHGNFVPDEDATVVRRLRQAG
AIIIGKTQMTEGAYSDYHPAITPSVNPWNADYWTGISSSGSAVAAAAGLCFGAIASDTGG
SIRWPAAANGVTGLKPTWGRVSRHGVFDLAPSLDHIGTIARNAMDAGIILAAIAGSDPKD
PTAAAQPVPDFASASRSGVGGLRIGFDPGWNSEDVEPQTQAALAAASDVFSDLGAHMVEI
RFPDVSQAVADWVPNCAVEAAAVHARDFAANKDLYGPILAGVIEKGKAVSEAEYQQILLR
RAIFRRDVEALFASVDLILTPVQPFAPLTLAAIATLGEQPDLIARLQRYTCPLDMSGHPA
LTFPAGVTKDEMPIGLQLLAGQFQELTLVRAGAAFQGHTAWHQRHPGKG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgatagtttcggatgatttcactttgctcagcctcacggagatcggagacagaatc
aaaagagggagcatttcctcgctggcgatcaccgaggcgcagcttcggcgcatcgcgcga
ctggaaccggacctccacgcctatgcgcaggtgatggacgcaagcgcgctggaacaggcg
aaggtggcggatgaggaaatcgccgctggacgccatcgcggcccgctgcacggcgttccg
atcgccgtcaaagacctgtgctggatcgaaggcgtgccaacgagggctggcacactcgtc
catggcaattttgttccggacgaagacgccactgtcgtcagacgcctcaggcaagcaggc
gcgatcattatcggcaagacgcaaatgaccgagggagcgtattcggactaccatccggca
ataaccccgtctgtcaatccatggaacgcggactactggaccgggatttcctcgagcggt
tcagctgtcgcggcggcagcgggcctttgtttcggtgcgatcgcgtccgacaccggcggc
tcgatccgctggccggcggccgcaaatggtgtcacgggcctcaaaccgacatgggggcgg
gtcagtcggcacggcgttttcgatctcgctccctccctcgaccacatcggtacgattgcg
cgaaacgccatggatgcggggatcattcttgccgccatcgcgggaagtgatccgaaggac
ccgacggcggcagcgcaaccggtgccggatttcgcttccgcttcgcgaagcggggtcggc
ggtctgcggataggctttgatccagggtggaacagcgaggacgtggagcctcagacacag
gccgcactcgccgcggcctcggacgttttttccgatcttggcgcgcacatggtcgagatc
aggttcccggacgtgagccaggccgttgccgattgggtgccgaactgcgccgtggaggcg
gcagccgttcacgcgcgagactttgctgcgaacaaagacttgtacgggcctatccttgcc
ggcgtcattgaaaagggcaaagccgtctcggaggcggagtatcagcagatccttctgcga
cgcgcgattttccgccgtgacgtcgaagccttgtttgcatccgtcgacctgattttgacc
ccggttcagccgttcgctcccctgacactcgctgccatcgcgacacttggtgagcagccg
gatctgatcgctaggctgcagcgctatacctgccccctcgatatgagcggccatccggca
ctgactttccctgcaggtgtcacaaaggacgagatgccgatcggccttcaattgctggct
ggtcagttccaggaactgacccttgtgcgcgccggagcggcattccaggggcatacggct
tggcaccagagacacccgggaaaagggtga

DBGET integrated database retrieval system