KEGG   Equus asinus (ass): 106823468Help
Entry
106823468         CDS       T04645                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
eai  Equus asinus (ass)
Pathway
eai05034  Alcoholism
eai05202  Transcriptional misregulation in cancer
eai05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:eai00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    106823468
  Immune diseases
   05322 Systemic lupus erythematosus
    106823468
  Substance dependence
   05034 Alcoholism
    106823468
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    106823468
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106823468
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 106823468
NCBI-ProteinID: XP_014684665
LinkDB All DBs
Position
Un
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtacgaagcagacagctcggaagtccaccggcggtaaggcgccccgcaagcag
ctggccaccaaggcggctcgcaagagcgcgccggccacgggcggcgtgaagaagccccac
cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagcttgcgcgccgcatccgcggggagagggcctag

DBGET integrated database retrieval system