KEGG   Equus asinus (ass): 106823969
Entry
106823969         CDS       T04645                                 

Gene name
NLRP4
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
eai  Equus asinus (ass)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eai04131]
    106823969 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:eai04054]
    106823969 (NLRP4)
Membrane trafficking [BR:eai04131]
 Autophagy
  Other autophagy associated proteins
   Others
    106823969 (NLRP4)
Pattern recognition receptors [BR:eai04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   106823969 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 VirE AAA_16 DUF4274 AAA_25
Other DBs
NCBI-GeneID: 106823969
NCBI-ProteinID: XP_014685466
LinkDB
Position
Un
AA seq 984 aa
MASSFFSDFGLLWYLGELKKDEFRKFKDFLKQEPLQLGLKPIPWAEVRKATREGLANLLV
KHYEEQEAWNVTFSIFHKIHRKDLCEKAKKEITGHTKTYQAHIQEKFNNMWFRESVTRIH
DYFDQKTTQKERESLERLFAPKETGKQPRTVVFKGIQGIGKTTFLIKLMLAWAEGSLYQE
RFFYVFYFCCREMKQLTQTSLAALISRDWPNSHVPLTEIMSQPERLLFVIDSFEELKHNL
DEPESDLCSDWMEQRPVRVLLSSLLRKKMLPECSLLIAAAPVYPGEIEDRLVCPEIKTFL
GFSESERKQYFCCIFQDRNRAMEAFSFVRENEQLFCMCQIPTLCWIVCTCLKHEMERGKD
LALTCRRTTSLYTSFIFNLFTAKGTSCPDQQSQSQLKGLCSLAAEGMWTDTFVFSEEDLR
RNGLVDSDIPTLLDMKALQKYRECENSYLFIHVCVQEFCAAMFYFLKSHIDHPNPAVGCT
ETLLFTYLKKVKVHWIYLGCFMFGLLNEKEQQKLDAFFGFHLSQEIQQKFRQCVQRIGES
EHLQGEVDFLALCYCLFEMQNEAFVKWAMALFQDVTFSIVDNADLVTSAYCLKHCSRLRK
LWLSIQNVFKEENANNPTSNYSFICWHHVCSVLTTNENLTELQVSDSSLNESAFVTLCNQ
LRHPSCHLQKLWINNVSFSAESWFFFEVLTLSPDLKYLNLNGTALSRKDVKLLCNALSNP
KCNVEELLLTNCCLSADDCEAFTWVLNSNNKLKLLNVSYNYLDKGVPLLCKALRHPDCAL
EVLVLGYCYLSGHCWKSLSDALLCNKSLVHLDLSANVLKSEELKLLCEALKQPSCQLQSL
CLLKCCITARGCQDLASVLTSNQNLTGLQIGYNDIEDVGAKLLCEALTHPQCRLENLGLG
ACKLTSACCKDFSSALTSSKTLRRLNLSGNALDHGGVVVLCEALRRPECPLQVLGLKKDE
FDEETQRLLMAEEERNPHLTIFSG
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggcgtcatctttcttttctgattttggccttctgtggtacctgggggagctcaaaaag
gatgagttcagaaaatttaaggatttcctcaaacaagagcctctgcaactcggactcaag
ccaattccctgggctgaagtaaggaaggcaacccgggaaggacttgctaacctattggtc
aaacattatgaggaacaagaagcatggaatgtgaccttcagcatcttccacaagatccat
agaaaggatctctgtgagaaggccaagaaagagattacaggacacaccaagacatatcaa
gctcatatacaggagaagttcaacaatatgtggttcagagaatctgtcactaggattcat
gactactttgaccagaaaaccacccagaaagaacgtgagtctttggaacgtctttttgcc
cctaaggaaactggaaaacagccacgaacagtggtctttaaaggaatacaagggataggg
aaaacgacgtttctgatcaagttgatgttggcctgggcagagggcagcctctatcaggag
agattcttttatgttttctacttctgctgccgggaaatgaagcagttgacacagacaagc
ttggcagcgctgatttccagagactggcccaactcccatgttccactaacggagatcatg
tcccagccagagagactcttgttcgtcattgatagctttgaagaactgaaacacaacctg
gatgaacctgagtcagatctgtgcagcgactggatggagcagcgaccagtacgggtgctc
ctgagtagcttgttgaggaagaaaatgctccccgagtgctcactgctcattgcagctgca
cctgtgtacccaggggaaattgaggataggttggtatgcccagaaattaaaacattcctg
ggattcagtgagagtgagaggaagcagtacttctgctgtatatttcaagacagaaataga
gccatggaagccttcagttttgtaagagaaaatgaacaactgttttgtatgtgccaaatc
cccaccctttgctggattgtgtgcacttgtctgaagcacgagatggaaagggggaaagat
ctggcactgacctgccgacgtaccacctctctttatacttctttcatctttaacttgttc
acagccaagggcactagttgtccagatcagcaaagccaaagccagttgaagggcttgtgt
tccctggctgcagagggcatgtggaccgacacgtttgtatttagtgaagaggatcttagg
agaaatgggttagtggattctgacattcctacattgctggacatgaaggctcttcagaag
tacagagaatgtgagaactcgtacctgttcatccatgtgtgtgtccaggagttctgtgcc
gccatgttctattttttgaagagccacatcgaccatccaaacccagctgttggatgtaca
gagacactactatttacctatttaaagaaagtaaaagtacattggatttatttggggtgt
ttcatgtttggccttttaaatgaaaaggagcaacaaaagctggatgcgttttttggcttc
cacctgtcccaagagatacagcagaaatttcgccagtgtgtgcagcgcataggtgagagt
gaacatcttcaaggagaggtagatttcttggcattgtgttactgtttgtttgagatgcag
aacgaagcctttgtaaagtgggcaatggccctcttccaagacgttacgttttctattgtt
gacaatgcagatttggtgacttctgcctactgcttaaaacactgttctcgcttgaggaaa
ctttggctttccatccaaaatgtctttaaagaagagaatgcaaacaaccccacgtcaaat
tacagtttcatctgttggcatcatgtctgctctgtgctcactacaaatgagaacctcaca
gaactccaagtgagtgacagcagcctcaacgagtcagcctttgtgactttgtgtaatcag
ctgaggcatcccagctgtcaccttcaaaagctttggataaataacgtttccttctctgct
gagagttggtttttctttgaggtgctcacgcttagcccggatttgaaatacctgaacctc
aatggcacagccctctcccgtaaggatgtgaagttgctctgtaacgccttgagcaatcca
aagtgcaacgtagaggaactgctgctgacaaattgttgcctctcagctgatgattgtgaa
gccttcacctgggtcttaaacagcaacaacaagctgaagcttcttaacgtatcatacaac
tacttggacaaaggcgtgcccctgttgtgtaaggccctgcgccacccagactgcgctctg
gaggtcttggtcttgggttactgctacctcagtggacactgctggaaaagcctctctgat
gctcttctgtgtaacaagagcttggtccatctagacctcagcgcaaatgtcctgaaatct
gaagaactgaaacttctctgcgaggccttgaaacagccaagctgccaactacagtcgctg
tgtttattaaaatgttgtatcactgcccgtggctgtcaagaccttgcctcagtcctcacc
agcaaccaaaacctgacaggtctgcaaattgggtacaacgatatagaagatgttggtgcg
aagctgttgtgcgaagctctgacacatccccaatgtcgcttagagaatcttgggctgggt
gcgtgcaagttaactagtgcctgctgcaaggatttctcttctgctctcaccagcagtaaa
actctgagaagactgaacctcagtggaaacgccttggaccacggtggggtggtggtgctg
tgtgaggccctgagacgcccggagtgccccttgcaggttctcgggctgaaaaaagatgaa
tttgatgaggaaacccagagacttctgatggctgaagaagagagaaatccccacttgaca
attttcagtggctaa

DBGET integrated database retrieval system