Equus asinus (ass): 106824114 Help Entry 106824114         CDS       T04645                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism eai  Equus asinus (ass) Pathway eai04060   Cytokine-cytokine receptor interaction eai04620   Toll-like receptor signaling pathway eai04622   RIG-I-like receptor signaling pathway eai04625   C-type lectin receptor signaling pathway eai04630   JAK-STAT signaling pathway eai04658   Th1 and Th2 cell differentiation eai04936   Alcoholic liver disease eai04940   Type I diabetes mellitus eai05133   Pertussis eai05134   Legionellosis eai05140   Leishmaniasis eai05142   Chagas disease eai05143   African trypanosomiasis eai05144   Malaria eai05145   Toxoplasmosis eai05146   Amoebiasis eai05152   Tuberculosis eai05162   Measles eai05164   Influenza A eai05168   Herpes simplex virus 1 infection eai05171   Coronavirus disease - COVID-19 eai05200   Pathways in cancer eai05321   Inflammatory bowel disease eai05330   Allograft rejection eai05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:eai00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     106824114 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106824114 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106824114 (IL12A)    04622 RIG-I-like receptor signaling pathway     106824114 (IL12A)    04625 C-type lectin receptor signaling pathway     106824114 (IL12A)    04658 Th1 and Th2 cell differentiation     106824114 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106824114 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     106824114 (IL12A)    05164 Influenza A     106824114 (IL12A)    05162 Measles     106824114 (IL12A)    05168 Herpes simplex virus 1 infection     106824114 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     106824114 (IL12A)    05134 Legionellosis     106824114 (IL12A)    05152 Tuberculosis     106824114 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     106824114 (IL12A)    05144 Malaria     106824114 (IL12A)    05145 Toxoplasmosis     106824114 (IL12A)    05140 Leishmaniasis     106824114 (IL12A)    05142 Chagas disease     106824114 (IL12A)    05143 African trypanosomiasis     106824114 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     106824114 (IL12A)    05330 Allograft rejection     106824114 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106824114 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     106824114 (IL12A)    04936 Alcoholic liver disease     106824114 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eai04052]     106824114 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:eai00536]     106824114 (IL12A) Cytokines and neuropeptides [BR:eai04052]  Cytokines   Interleukins    106824114 (IL12A) Glycosaminoglycan binding proteins [BR:eai00536]  Heparan sulfate / Heparin   Cytokines    106824114 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  106824114 NCBI-ProteinID:  XP_014685739 UniProt:  A0A8C4MLX6 LinkDB All DBs Position 5:complement(51200730..51207254) Genome browser AA seq 256 aa AA seqDB search MSPPGPGSPPPPSPAASTRRRPAASPESAQRPLAMCAPRGLLIVAILVLLNHLDHLSLAR NLPTATPGPGMFQCLNHSQNLLRTVSNTLQKARQTLEFYSCTSEEIDHEDITKDKSSTVA ACLPLELAPNESCLASREISFITNGSCLTPGKASSMMTLCLSSIYEDLKMYQVEFKAMNA KLLMDPQRQIFLDENMLTAIDKLMQALNFNSETVPQKPSLEELDFYKTKVKLCILLHAFR IRAVTINRMMSYLNSS NT seq 771 nt NT seq  +upstreamnt  +downstreamnt atgtcaccccccgggccgggctcgccaccaccgccctcacctgcggcgtccacccgtcgg cgtcccgcggccagtccagagtcggcgcagcgcccgctcgccatgtgcgccccgcgcggc ctcctcattgtggccatcctggtcctcctaaaccacctggaccacctcagtttggccagg aacctccccacagccacaccaggcccaggaatgttccagtgcctcaaccactcccaaaac ctgctgaggaccgtcagcaacacgcttcagaaggccaggcaaaccctagaattctactcc tgcacttctgaagagatcgatcatgaggatatcacaaaagacaagagcagcaccgtggcg gcctgcctccccctggaacttgccccgaacgagagttgcctggcttccagagagatctct ttcataactaatgggagttgcctgacccccggaaaggcctcttctatgatgacgctgtgc cttagcagcatctatgaggacttgaagatgtaccaggtggagttcaaggccatgaatgcc aagctgttgatggatcctcagaggcagatctttctggatgagaacatgctgacagccatt gacaagctgatgcaggccctgaacttcaacagtgagactgtgccacaaaagccctccctt gaagaactggatttttataaaactaaagtcaagctctgcatccttcttcatgccttcaga atccgtgcagtgaccatcaacaggatgatgagctatctgaattcttcctaa

DBGET integrated database retrieval system