KEGG   Equus asinus (ass): 106824579
Entry
106824579         CDS       T04645                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
eai  Equus asinus (ass)
Pathway
eai01522  Endocrine resistance
eai01524  Platinum drug resistance
eai04012  ErbB signaling pathway
eai04066  HIF-1 signaling pathway
eai04068  FoxO signaling pathway
eai04110  Cell cycle
eai04115  p53 signaling pathway
eai04151  PI3K-Akt signaling pathway
eai04218  Cellular senescence
eai04630  JAK-STAT signaling pathway
eai04921  Oxytocin signaling pathway
eai04928  Parathyroid hormone synthesis, secretion and action
eai04934  Cushing syndrome
eai05160  Hepatitis C
eai05161  Hepatitis B
eai05163  Human cytomegalovirus infection
eai05165  Human papillomavirus infection
eai05166  Human T-cell leukemia virus 1 infection
eai05167  Kaposi sarcoma-associated herpesvirus infection
eai05169  Epstein-Barr virus infection
eai05200  Pathways in cancer
eai05202  Transcriptional misregulation in cancer
eai05203  Viral carcinogenesis
eai05205  Proteoglycans in cancer
eai05206  MicroRNAs in cancer
eai05210  Colorectal cancer
eai05211  Renal cell carcinoma
eai05212  Pancreatic cancer
eai05213  Endometrial cancer
eai05214  Glioma
eai05215  Prostate cancer
eai05216  Thyroid cancer
eai05217  Basal cell carcinoma
eai05218  Melanoma
eai05219  Bladder cancer
eai05220  Chronic myeloid leukemia
eai05222  Small cell lung cancer
eai05223  Non-small cell lung cancer
eai05224  Breast cancer
eai05225  Hepatocellular carcinoma
eai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106824579 (CDKN1A)
   04630 JAK-STAT signaling pathway
    106824579 (CDKN1A)
   04066 HIF-1 signaling pathway
    106824579 (CDKN1A)
   04068 FoxO signaling pathway
    106824579 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    106824579 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106824579 (CDKN1A)
   04115 p53 signaling pathway
    106824579 (CDKN1A)
   04218 Cellular senescence
    106824579 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    106824579 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    106824579 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106824579 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    106824579 (CDKN1A)
   05206 MicroRNAs in cancer
    106824579 (CDKN1A)
   05205 Proteoglycans in cancer
    106824579 (CDKN1A)
   05203 Viral carcinogenesis
    106824579 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106824579 (CDKN1A)
   05212 Pancreatic cancer
    106824579 (CDKN1A)
   05225 Hepatocellular carcinoma
    106824579 (CDKN1A)
   05226 Gastric cancer
    106824579 (CDKN1A)
   05214 Glioma
    106824579 (CDKN1A)
   05216 Thyroid cancer
    106824579 (CDKN1A)
   05220 Chronic myeloid leukemia
    106824579 (CDKN1A)
   05217 Basal cell carcinoma
    106824579 (CDKN1A)
   05218 Melanoma
    106824579 (CDKN1A)
   05211 Renal cell carcinoma
    106824579 (CDKN1A)
   05219 Bladder cancer
    106824579 (CDKN1A)
   05215 Prostate cancer
    106824579 (CDKN1A)
   05213 Endometrial cancer
    106824579 (CDKN1A)
   05224 Breast cancer
    106824579 (CDKN1A)
   05222 Small cell lung cancer
    106824579 (CDKN1A)
   05223 Non-small cell lung cancer
    106824579 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106824579 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106824579 (CDKN1A)
   05161 Hepatitis B
    106824579 (CDKN1A)
   05160 Hepatitis C
    106824579 (CDKN1A)
   05163 Human cytomegalovirus infection
    106824579 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106824579 (CDKN1A)
   05169 Epstein-Barr virus infection
    106824579 (CDKN1A)
   05165 Human papillomavirus infection
    106824579 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106824579 (CDKN1A)
   01522 Endocrine resistance
    106824579 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106824579
NCBI-ProteinID: XP_014686455
LinkDB
Position
Un
AA seq 164 aa
MSEPARDARPIPRGSKACRRLFGPVDGEQLRRDCDALMASCAQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLSPGPRGSRDDLRGGKRPSTSPALLQGTAEEDHVDLSLSCTLL
PHPPERPEGSPGEPGTSQGRKRRQTIMTDFYHSKRRRIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccggccagggatgctcgtccgatcccgcgtggcagcaaggcctgccgccgc
ctcttcggcccggtggacggcgagcagctgcgccgagactgtgacgcgctgatggccagc
tgcgcacaggaggcccgggagcgatggaacttcgattttgtcaccgagacaccgctggag
ggcgacttcgcctgggagcgcgtgcggggcctcggcctgcccaagctctacctgtccccg
gggccccgggggagccgggacgacctgagagggggcaagcggcccagcacgtcgcctgcc
ctgctgcaggggacagccgaggaggaccacgtggacctgtcgctgtcctgtaccctcctg
cctcacccccctgagcggcctgaggggtccccgggggagcctggcacctctcagggccga
aaacggcggcagaccatcatgacagatttctaccactccaaacgccgccggatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system