KEGG   Equus asinus (ass): 106825573Help
Entry
106825573         CDS       T04645                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
eai  Equus asinus (ass)
Pathway
eai00500  Starch and sucrose metabolism
eai01100  Metabolic pathways
eai04151  PI3K-Akt signaling pathway
eai04152  AMPK signaling pathway
eai04910  Insulin signaling pathway
eai04922  Glucagon signaling pathway
eai04931  Insulin resistance
Module
eai_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106825573 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    106825573 (GYS2)
   04152 AMPK signaling pathway
    106825573 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106825573 (GYS2)
   04922 Glucagon signaling pathway
    106825573 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    106825573 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eai01003]
    106825573 (GYS2)
Enzymes [BR:eai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     106825573 (GYS2)
Glycosyltransferases [BR:eai01003]
 Polysaccharide
  Storage polysaccharide
   106825573 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 106825573
NCBI-ProteinID: XP_014687935
LinkDB All DBs
Position
Un
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLGGLPRWEVAELPVEDVLLFEVSWEVTNKVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDTMNKHGCQVRFGRWLIEGSPYVVLFDI
GFSAWNLDRWKGDLWEACSVGIPYDDREANDMLIFGSLTAWFLKEVTDHADGKHVIAQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDQFNIDKEAGERQIYH
RYCMERAAVHCAHVFTTVSEITAIEAEHMLKRKPDVITPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEYSNKGADILLESLSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSMKEKFGQKLYDALLKGEIPDMNNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSSDPILSTIRRLGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFCSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARYLTLSKAFPDKFHMEPTSPPTTEGFKYPRPSSVPPSPSGSQVCSPQSSDVE
DEDEDERYDEEEEAERDRLNIKSPFALSHVHHRKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggggtcgatctttgtctgtgacatcccttggagggcttcccaggtgggaagtt
gccgaacttcccgtggaagacgtactgctatttgaagtctcttgggaagtgaccaataaa
gttggtggcatttatactgtgattcagacgaaggccaaaacaacggcagatgaatgggga
gacaattattttctgattggtccatattttgaacataatatgaagacccaggtggaacag
tgtgaacctgtaaatgatgctgttagaagagcagtggacacaatgaataaacatggctgc
caggtgcgctttggaagatggctgatagaagggagtccttatgtggtgctcttcgacata
ggcttttcggcttggaatctggacaggtggaagggtgacctttgggaagcgtgcagcgtc
ggcatcccttatgacgaccgcgaagccaacgatatgttgatatttggatctttaactgct
tggttcttaaaagaggtgacagatcatgcagatgggaaacacgtcattgcccagttccac
gaatggcaggccggaactggactgatcctttctcgagcccggaaactgccgatcgctacg
atatttaccacccacgccacgctgcttgggaggtatctctgtgcagcgaacattgatttc
tacaatcatcttgatcagtttaacatagacaaagaggccggggaaaggcagatttaccac
cggtactgcatggagcgagccgctgtccactgtgctcacgtcttcaccacggtgtctgag
ataacagcaatagaggcagaacacatgctgaagaggaagccagatgtaatcactccaaat
ggcttgaatgttaaaaaattttcagcagtacatgagtttcaaaatctgcacgccatgtac
aaggccaggatccaagattttgttcgaggtcatttctatggtcatctggactttgatctt
gaaaagactttgttccttttcattgctgggaggtatgagtattcaaacaaaggagctgac
atcctcctagaatctttatccaggctaaatttcctgctcaggatgcataaaagtgacgtc
acggtggtggtgtttttcatcatgcctgccaagacaaacaatttcaatgtggaaaccctg
aagggccaggcagtgcgcaaacagctatgggacattgcacattccatgaaggaaaagttt
ggacagaaactctatgatgccttattaaaaggagaaattcctgacatgaacaatattttg
gatcgagatgatctaacaattatgaaaagagccatcttttcaacccagcgacagtctttg
cctccagtcaccactcacaacatgattgatgactccagtgatcccatcctcagcaccatt
agacggcttgggcttttcaacagccgcacagacagagtcaaggtgattttgcacccagag
ttcctatcctccacgagcccattattacccatggattatgaagagtttgtccgaggttgt
catcttggagtatttccgtcttactatgaaccgtggggttatactccagctgaatgcacc
gtgatgggcatccccagtgtgacaaccaacctttctggctttggctgtttcatgcaggag
cacgtggctgatccgactgcatacggtatttacatcgttgacaggcggttctgctctcca
gatgattcctgcaatcagctgactaagtttctctatggattttgcaaacagtcacgccgc
cagagaattatccagaggaaccgaactgagaggctctcagatcttctggattggagatac
ttgggcagatattaccagcatgccaggtacctgacattaagcaaagcttttccagataaa
ttccatatggaacctacatcaccaccaacgacagaaggatttaaatatcccaggccttcc
tcagtaccaccttccccttcggggtctcaggtctgcagtcctcagagcagtgatgtggag
gatgaagatgaggatgagcgatacgatgaggaagaggaggcggagagggatcgcttaaac
atcaagtcaccgtttgctctaagtcatgttcaccacaggaagaagaagctgcacggcgaa
tacaagaactga

DBGET integrated database retrieval system