KEGG   Equus asinus (ass): 106825829Help
Entry
106825829         CDS       T04645                                 

Definition
(RefSeq) huntingtin-like
Organism
eai  Equus asinus (ass)
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT HEAT_2 HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 106825829
NCBI-ProteinID: XP_014688299
LinkDB All DBs
Position
Un
AA seq 1130 aa AA seqDB search
MELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW
RFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAIPKIMASFGNFANDNEI
KVLLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYTWLLNVLLGLLVPVEDEHST
LLILGVLLTLRYLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSTEQLVQVYELTLHYTQHQ
DHNVVTGALELLQQLFRTPPPELLQALTTAGGLGRLAAAKDEPSCRSRSGSIVELIAGGG
SSCSPVLSRKQKGKVLLGEAAALEEDSESRSDSSSPAFAASVKGEIGGELAASSGVSTPG
SASSAADSAGHDIITEQPRSQHTLQPDSVDLTGCDLTSAATDGVEEDILSHSSSQISAVP
SDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGPDGQYSGMQIGQPRDE
GEEAAGLLPDEDVDAFTDSAVALQQAHLLERLGHSRQPSDSSIDKFVSRDEATEPGDQEN
KPCRIKGDIGRSADDDSAPLVHCVRLLSASFLLTGEKNALVPDRDVRVSVKALALSCVGA
AVALHPESFFSKLYKVPLETTEYPEEQYVSDVLNYIDHGDPQVRGATAILCGTLVYSILS
RSRFHVGDWVATVRTLTGNTFSLVDCIPLLQKTLKDESSVTCKLACTAVRHCVMSLCSSS
YSEFGLQLITDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENIHRGAHHYTGRL
KLQERVLNNVVIYLLGDEDPRVRHVAAASLMRLVPKLFYKCDQGQADPVVAVARDQSSVY
LKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRAL
TFGCCEALCLLSTAFPVCVWSLGWHCGVPPLSASDEARKSCTVGMATMILTLLSSAWFPL
DLSAHQDALILAGNLLAASAPKSLRSSWTSEEEANPAATKQEEIWPALGDRTLVPMVEQL
FSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPK
KGNEASPASRQSDTSGPVPANKSSSLGSFYHLPSYLKLHDVLKATHANYK
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atggaactttttctgctgtgcagtgatgacgcagagtcagatgtcaggatggtggctgac
gaatgcctcaacaaagtcataaaagctttgatggattctaatcttccaaggttacagtta
gaactctataaggaaattaaaaagaacggtgctcctcggagcctgcgtgctgccctgtgg
aggtttgctgagctggctcacctggttcggcctcagaaatgcaggccttacttggtaaac
cttttgccttgcctgactcgaacaagcaaaagacctgaggaatctgttcaggagaccttg
gctgcagctatacccaaaattatggcttcttttgggaattttgcaaatgacaatgaaatt
aaggttctgttaaaggctttcatagcaaatctgaagtcaagctcccctaccattcggcgg
acagcagctggctcagcagtgagcatctgtcagcactcaagaaggacgcagtatttttat
acctggctactaaatgtactcttaggtttgctagttcctgtcgaggatgaacattccacc
ctcctgattcttggagtgctgctcacattgcggtatttggtgcccttgctacagcagcag
gtcaaggacacaagcctgaaaggcagctttggggtgacacggaaagaaatggaagtctct
ccctcgacagagcagcttgtccaggtttacgaattgaccttgcattatactcagcaccaa
gaccacaatgtggtgactggagcattagaactcctgcagcagctcttcagaacccctcct
ccggagctcctgcaagctctgaccacggcaggtggccttgggcggctcgctgcggctaaa
gatgagcccagttgccgaagtcgtagcgggagtattgtggaacttatagccggagggggt
tcttcatgcagccctgtcctttcaagaaaacaaaaagggaaagtgctcttgggagaagca
gcagccttggaggaggactctgagtcaaggtctgacagcagcagcccagcctttgcagcc
tcagtcaagggtgagattggtggtgagctggctgcctcttcaggggtctccactcctggc
tctgctagctcagccgctgactctgcgggtcacgacattatcaccgagcagccccggtca
cagcatacactgcagccagactcagtggatctgactggctgtgacttgacgagcgctgcc
accgatggggttgaggaggacatcttgagccacagctccagccagatcagcgctgtcccg
tctgatcctgccatggacttgaatgatgggacgcaggcatcctcgcccatcagtgacagc
tcacaaaccaccactgaagggccggattcggccgtgaccccttcggacagttctgaaatt
gtgttagatggtcctgatggccagtattcggggatgcagatcggacagccgcgggacgag
ggtgaggaggccgcaggtcttcttcccgatgaagacgtggatgctttcacagactccgca
gttgcccttcaacaagcacatttgttggaaaggctgggccacagcaggcagccctctgac
agcagtatagataaatttgtctcaagagatgaagctactgaaccaggagatcaagaaaac
aagccttgccggatcaaaggagacataggacgatctgctgatgatgattctgctcctctc
gtccactgtgtccgccttttgtctgcttcatttttgctaactggggaaaaaaatgccttg
gttccggacagggacgtgagggtcagtgtgaaggcgctggccctcagctgtgtgggagct
gctgtggcccttcatccagaatctttcttcagcaaactttataaagtacctcttgaaacc
acggaataccctgaggagcagtatgtctcagacgtcttgaactacattgaccatggagat
ccgcaggtcagaggagccacagccattctctgtgggacccttgtctactccatcctcagc
aggtcccgcttccatgtgggagactgggtggccaccgttagaacactgacaggaaatacg
ttttctctggtggactgcattcctttgctgcagaaaactttgaaggatgaatcttctgtt
acttgcaagttggcttgtacagctgtgaggcactgcgtcatgagtctttgtagcagcagc
tatagtgaattcggattgcagctgatcaccgatgtgctgactctgaggaatagttcctat
tggctggtgaggacagagcttttggaaactcttgcagagatcgactttaggttggtgagc
tttttggaggcaaaagcggaaaacatacacagaggggctcatcattacacagggcggtta
aaactgcaagaacgagtgctcaataatgttgtcatctatttgcttggggatgaagacccc
agggtgcgacatgttgctgcagcttcattaatgaggcttgtcccaaagctgttttataaa
tgtgaccaaggacaagctgatccagtagtggctgtggcaagagatcaaagcagtgtttac
ctgaaacttctcatgcatgagacgcagcctccatctcacttctccgtcagcacgataacc
agaatatatagaggctataacttactaccaagcataacagatgtcactatggaaaataac
ctctcgagagttattgcagcggtttctcatgaactaatcacatcaaccacgcgagcgctc
acatttggatgctgtgaagctctgtgtcttctttcaactgcctttccagtttgcgtttgg
agtttggggtggcactgtggagtgccccctctgagtgcctcagatgaggccagaaagagc
tgtactgtcgggatggccacgatgatccttaccctgctgtcgtcagcgtggttcccgttg
gatctctcagcccatcaagatgctttgattttggctggaaacttgcttgcagccagtgcc
cccaaatctctaagaagttcatggacctctgaagaagaggccaacccagcagccaccaaa
caggaagagatctggccagctctgggtgaccggaccctagtgcccatggttgagcagctc
ttctcccacctgctgaaggtgattaatatctgtgcacatgtcttggatgatgtggctcct
ggaccagcaataaaggcagccttgccatctctaacaaaccccccttctctaagtccaatc
cgacgaaagggaaaggaaaaagaaccgggagagcaggcttctgtaccattgagtcccaag
aaaggcaatgaagccagtccagcttctcgacaatctgatacctcagggcctgttccagca
aataaatcctcatcactgggaagtttctatcatcttccttcatacctcaaattgcatgat
gtcctgaaagctactcatgctaactacaag

DBGET integrated database retrieval system