KEGG   Equus asinus (ass): 106826745
Entry
106826745         CDS       T04645                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
eai  Equus asinus (ass)
Pathway
eai01522  Endocrine resistance
eai04012  ErbB signaling pathway
eai04066  HIF-1 signaling pathway
eai04068  FoxO signaling pathway
eai04110  Cell cycle
eai04151  PI3K-Akt signaling pathway
eai04933  AGE-RAGE signaling pathway in diabetic complications
eai04934  Cushing syndrome
eai05162  Measles
eai05165  Human papillomavirus infection
eai05169  Epstein-Barr virus infection
eai05200  Pathways in cancer
eai05202  Transcriptional misregulation in cancer
eai05203  Viral carcinogenesis
eai05206  MicroRNAs in cancer
eai05215  Prostate cancer
eai05220  Chronic myeloid leukemia
eai05222  Small cell lung cancer
eai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106826745 (CDKN1B)
   04066 HIF-1 signaling pathway
    106826745 (CDKN1B)
   04068 FoxO signaling pathway
    106826745 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    106826745 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106826745 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106826745 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    106826745 (CDKN1B)
   05206 MicroRNAs in cancer
    106826745 (CDKN1B)
   05203 Viral carcinogenesis
    106826745 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    106826745 (CDKN1B)
   05220 Chronic myeloid leukemia
    106826745 (CDKN1B)
   05215 Prostate cancer
    106826745 (CDKN1B)
   05222 Small cell lung cancer
    106826745 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106826745 (CDKN1B)
   04934 Cushing syndrome
    106826745 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    106826745 (CDKN1B)
   05169 Epstein-Barr virus infection
    106826745 (CDKN1B)
   05165 Human papillomavirus infection
    106826745 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    106826745 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106826745
NCBI-ProteinID: XP_014689732
LinkDB
Position
Un
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDASANRQAVPLIG
SQANSEDTHLVDPKTDTSDSPTGLAEPCTGIRKRPAADDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtccaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccgtccgcctgcagaaacctcttcggcccggtgaatcacgaagag
ttaacccgggacttggagaagcactgccgagacatggaagaggccagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaggaggtggaa
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgccagcgcgaaccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacgcatttggtagacccaaagactgatacgtcggacagc
cccacgggcttagcggagccgtgcactgggatcaggaagcgacctgcagcagacgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccgaac
gcgggctcagtggagcagacgcccaagaagccgggcctccgaagacgtcaaacgtaa

DBGET integrated database retrieval system