KEGG   Equus asinus (ass): 106826974Help
Entry
106826974         CDS       T04645                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
eai  Equus asinus (ass)
Pathway
eai05034  Alcoholism
eai05165  Human papillomavirus infection
eai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    106826974 (HDAC6)
  09164 Substance dependence
   05034 Alcoholism
    106826974 (HDAC6)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    106826974 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:eai01009]
    106826974 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:eai03019]
    106826974 (HDAC6)
   04131 Membrane trafficking [BR:eai04131]
    106826974 (HDAC6)
   03036 Chromosome and associated proteins [BR:eai03036]
    106826974 (HDAC6)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106826974 (HDAC6)
Protein phosphatases and associated proteins [BR:eai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106826974 (HDAC6)
Messenger RNA biogenesis [BR:eai03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     106826974 (HDAC6)
Membrane trafficking [BR:eai04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    106826974 (HDAC6)
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106826974 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 106826974
NCBI-ProteinID: XP_014690063
LinkDB All DBs
Position
Un
AA seq 1201 aa AA seqDB search
MTSTGQDSTTTRQRRSRHNPHSPPHDSSVASKRSVKKGATLRSSPNLAEVKKKGRMKKLS
QAADQDLIMGLQGLDLNLEAKTLSGTGLVFDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNERELRILADTYDSVYLHPNS
YTCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHEIQRILIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASDWSTIGFGQG
RGYTINVPWNQVGMRDADYIAAFLHILLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAHLTHLLMGLAGGKLILSLEGGYNLRSLAEGVSASLHTLLGDPCPMLESPGAPCLSA
QASLSCTLEALEPFWEVLVRSVETMEEDIVEGDNVEEKEEGPWQPPALPVLTWPVLQART
GLVYDQRMMGHYNLWDSHHPEMPQRVSRIMRRLEELHLAERCLTLPARPATDAELLTCHS
AEYVGRLRATEKMKTRELHREGANFDSIYICPSTFACAQLATGAVCRLVEAVLAGEVLNG
IAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQAISGHALRILIVDWDVHHGNGTQHIFE
EDPSVLYISLHRYDHGTFFPLGDEGASSQMGRAAGTGFTVNVTWNGPRMGDADYLAAWHR
LVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLANGHIILILEGG
YNLTSISESMAACTRSLLGDPPPLLTLTRPPLAGALASITETIQVHRRYWRSLQITKVED
KEGPSSSLLITKKAPQPANPGSAKEMITPEGNILDAGRGKATSVSPVEESTAGQTKSETA
VVELTQDKSLEAATEEATLDQTTSETATGEATLAQTTSEMATGDATLDQTTSEIAMGGAT
LDQTTLGATPGVATVDQTTSETTTGVTTLDQTTSEAVRGAELIQVPLASSTDNQTPPASP
VEGDPPHISPSKLIGNLRTLELDNEAQEAPESQSPEEERLLGEATGGQDMDDLVLMQSFG
DNADTDQAMFYAVTPLPWCPHLVAVSPVPDTGLDVTQPCQDCGALQENWVCLSCHQVYCG
RYINAHMLQHHEGSGHPLVLSYVDLSTWCYYCQAYVHHQALLDAKNVAHQNKFGEGMPHS
H
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgacctctaccggccaggattccaccacaaccaggcagcgaaggagtaggcacaacccc
cactcccccccccacgactccagcgtcgcctcgaagaggagtgttaagaagggtgccaca
ctccgctccagccctaatctagcggaggtaaagaagaaaggcagaatgaagaagctcagc
caagcagccgaccaagacctaatcatggggctgcaagggctggatctgaaccttgaggcc
aagacgctgtctggcactggcttggtgttcgatgagcagctaaatgaatttcattgcctc
tgggatgacagcttccctgaaggccctgagcggctccatgccatcaaggagcagctgatc
caggagggcctcttggaccgctgtgtgtcctttcaggcccggttcgccgaaaaggaggag
ctgatgttggttcacagcctagaatatattgatctgatggagacgacccaatacatgaat
gaaagggaactccgcatcctagcagacacctatgactcagtttatctgcatccgaactca
tacacctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgctgtcctgggg
gccgagatccggaatggcatggccatcatcaggcctcctggacaccatgcccagcacagt
cttatggatgggtattgcatgttcaaccatgtggccgtggctgcccgctacgctcaacag
aagcatgaaattcagaggatccttatcgtggattgggatgtacaccatggtcaaggaaca
cagttcacctttgaccaggaccccagcgtcctctatttctccatccaccgctatgagcag
ggtcggttctggccccaccttaaggcctctgactggtccaccataggttttggccaaggc
cggggatacaccatcaatgtgccttggaaccaggtgggcatgcgagatgccgactacatt
gctgctttcctgcacatcctgctgccagtcgccctggagttccagccgcagctagtcctg
gtggctgctggatttgatgccctccaaggggaccccaagggtgagatggctgccactcca
gcagggttcgcccacctgacccacctgctcatgggtctggcaggaggcaagctgatcctg
tctctggagggtggctacaacctccgctctctggctgagggtgtcagcgcctcgctccac
acccttctgggagatccttgccccatgctggaatcccctggtgccccctgcctgagtgcc
caggcatcactctcctgcactctggaagccctggagcccttctgggaggtccttgtgaga
tcagttgagaccatggaggaggacattgtggagggggacaacgtggaggagaaagaggag
ggaccatggcagccccctgcactcccagtcctgacgtggcctgtgctgcaggctcgcacc
gggctggtctatgaccagcggatgatgggtcactacaacttgtgggacagccatcacccc
gagatgcctcagcgtgtctcacggatcatgcgccgtctggaggagctgcaccttgccgag
cgctgccttaccctgcccgcacgtcccgccacagatgctgagcttcttacctgccacagt
gctgaatatgtgggtcgtctacgggccacggagaagatgaaaacccgggagctgcaccgt
gagggcgccaactttgactccatctacatctgccccagcaccttcgcctgcgcgcagctg
gccactggcgctgtgtgccgcctggtggaggctgtgctggcgggagaggttttgaatggt
attgctgtggtgcgtcccccgggacaccacgcagagcaggatgccgcttgtggtttctgc
tttttcaactctgtagctgtggctgctcgccatgcccaggccatcagtgggcatgcgctg
cggatcctgatcgtagactgggacgtccatcacggtaatggaactcagcacatatttgag
gaggaccccagcgtgctgtacatttccctgcaccgctatgatcacggtaccttcttcccc
ctgggggatgagggcgccagcagccagatgggccgggctgcaggcacaggcttcactgtc
aatgtgacctggaacgggccccgcatgggtgacgctgactacctggctgcctggcatcgc
ctggtgcttcccattgcctatgagtttaacccagaactggtgctagtctcagctggcttt
gacgctgcacggggtgacccactgggtggttgccaggtgtcgcctgagggctatgcccac
ctcacccacctgctgatgggccttgccaatggccacattatcctaatcctagagggtggc
tataatctgacatccatctcagagtccatggctgcttgcacccgctccctccttggggac
ccaccacctctgctgaccctgacacggcccccactagcaggggccctggcctccatcact
gagaccatccaagtccatcgcagatactggcgcagcttgcagatcacaaaggtcgaagac
aaggagggaccatccagttctttgttgatcaccaagaaggcaccccaaccagccaatcct
gggtcagccaaggagatgatcacaccagaagggaacattctggatgcaggcagggggaag
gccacctcagtatcacctgtagaagagtctactgcaggccagactaagtcagagacagct
gtggtggagctcactcaggacaagtccttggaggcagccacagaggaagccacgctggac
cagaccacctcagagacagccacaggggaagccacgctggcccagaccacctcagaaatg
gccacaggggatgccacgctggaccagaccacctcagagatagccatggggggagccacg
ctggaccagaccaccttgggggcaaccccaggagtagccacagtggaccagaccacctca
gagacaaccacaggagtaaccacgctggatcagaccacctcagaggctgtcaggggagct
gagctgatccaagtccctctagcctcaagcactgacaaccagactcccccagcctcacct
gtggaaggagacccaccccacatatcccctagtaagctgattgggaatctcaggaccttg
gaactagacaacgaggctcaggaggcaccagaatctcagagccctgaagaggagagacta
ctaggagaggcaactggaggtcaagacatggatgatttagtgctgatgcagagctttggg
gacaatgccgacactgaccaggccatgttttatgccgtgacaccactgccctggtgtcct
catttggtggcagtaagccccgtacctgacacaggcctggacgtgacccaaccttgtcag
gactgtggagcactccaggagaactgggtgtgtctgtcttgccatcaggtctactgtggt
cgttacatcaatgcccatatgctccaacaccatgaaggctcaggacaccctctggtcctc
agctacgtcgacctgtctacctggtgttactactgtcaggcttatgtccaccaccaggct
ctcctagatgcgaagaacgtcgcccaccagaacaagtttggggagggcatgccccactca
cactaa

DBGET integrated database retrieval system