KEGG   Equus asinus (ass): 106827983Help
Entry
106827983         CDS       T04645                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
eai  Equus asinus (ass)
Pathway
eai00020  Citrate cycle (TCA cycle)
eai00190  Oxidative phosphorylation
eai01100  Metabolic pathways
eai01200  Carbon metabolism
eai04714  Thermogenesis
eai04932  Non-alcoholic fatty liver disease (NAFLD)
eai05010  Alzheimer disease
eai05012  Parkinson disease
eai05016  Huntington disease
Module
eai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eai_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106827983 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106827983 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    106827983 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    106827983 (SDHB)
   05012 Parkinson disease
    106827983 (SDHB)
   05016 Huntington disease
    106827983 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    106827983 (SDHB)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106827983 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 106827983
NCBI-ProteinID: XP_014691668
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAAVGVSLRRRFPATALGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQGGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggtcggagtctccttgaggcgcaggttcccggccacagcccttggcgga
gcgtgcctgcaggcctgccgaggggcccagacagctgcggccacagctccccgaatcaag
aaattcgccatctaccgatgggatccagacaagactggagataaacctcatatgcaaact
tatgaaattgatttgaataaatgtggtcctatggtgttggatgctttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcatgcagagaaggcatctgcggctcc
tgtgcaatgaacatcaatggaggcaacactctagcgtgcacccggcggattgacaccaac
ctcagcaaagtctcaaaaatctaccctctcccgcatatgtatgtgatcaaggacctggtt
cctgatttgagcaacttctatgctcaatacaaatccatcgagccttatttgaagaagaag
gatgaatcccagggaggcaagcagcagtatctacagtccatagaggagcgtgagaaactg
gacgggctctacgagtgcatcctctgtgcctgctgcagcaccagctgccctagctactgg
tggaacggggacaagtatttgggccctgcggttctgatgcaggcctatcgctggatgatc
gactccagggacgacttcacagaggagcgcctggccaagctgcaggaccccttctctctc
taccgctgccacaccatcatgaactgcacgaagacctgtcccaaggggctgaatccgggg
aaagctattgctgaaatcaagaaaatgatggcaacctataaggagaagaaagcttcagct
taa

DBGET integrated database retrieval system