KEGG   Equus asinus (ass): 106828097Help
Entry
106828097         CDS       T04645                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
eai  Equus asinus (ass)
Pathway
eai00500  Starch and sucrose metabolism
eai01100  Metabolic pathways
eai04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106828097
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    106828097
Enzymes [BR:eai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     106828097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 106828097
NCBI-ProteinID: XP_014691818
LinkDB All DBs
Position
Un
AA seq 511 aa AA seqDB search
MKFLLLLSAIGFCWAQYDPHTQSGRTSIVHLFEWRWADIALECERYLAPKGFGGVQVSPP
NENIIVNNPPRPWWERYQPISYKLCTRSGSESEFRDMVTRCNNVGVRIYVDAVVNHMCGS
GGGAGTSSTCGSYYNAGSRDFPAVPYSGWDFNDGKCNTGSGEVENYNDIYQVRNCRVVGL
LDLALEKDYVRSTIAAYLNRLIDIGVAGFRLDAAKHMWPGDIKAFLDKLHNLNTKWFPQG
SKPFIYQEVIDLGTEPIKGSEYFGNGRVTEFKYGAKLGTVLRRWNGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDSRLYKMAVGFMLAHPYGFTRIMSSYRWA
RNFQNGKDVNDWIGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVNGQP
FTNWWDNGSNQVAFGRGNRGFIVFNNDDWALSSTLQTGLPGGTYCDVISGDKINGNCTGI
KINVSSDGKAYFSISNTAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccttctgttactttcagccattgggttctgctgggctcagtatgacccacat
acccaaagtggacggacatcgattgtgcatctgtttgagtggcgctgggctgatattgct
cttgaatgtgagcgatacttagctcccaaaggatttggaggggttcaggtctctccaccc
aatgaaaatatcatagttaataaccctccaagaccttggtgggaaagataccaaccaatt
agctacaagttatgtacaaggtctggaagtgaaagtgaattccgagacatggtgaccaga
tgtaacaacgtcggtgttcgtatttatgtggatgctgtagttaatcatatgtgcggaagt
ggtggcggtgcaggaacgagcagtacttgcggaagttactacaacgctggaagtagggac
ttcccagcagtcccatactctggttgggattttaatgatggtaaatgtaacactggaagt
ggagaggttgagaactataatgatatctaccaggtcagaaattgtcgcgtggttggtctt
cttgatcttgcgctggagaaagattatgtgcgttccacgattgctgcctatctgaatcgc
ctcatcgacattggtgtagcagggttcagattggatgctgctaagcacatgtggcctgga
gacataaaggcatttttggataaactgcataatctaaacacaaagtggttccctcaagga
agtaaacctttcatttaccaggaggtaattgatctgggtactgagccaattaaaggcagc
gagtactttgggaatggccgtgtgacagaattcaagtatggtgctaaactaggcacagtt
ctgcgcaggtggaatggagagaagatggcatacttaaagaactggggagaaggctggggt
ttcatgccttcagacagagcacttgtctttgtggataaccatgacaatcagcgaggacat
ggagctggaggagcgtctattcttacattctgggactctagactgtacaaaatggcagtt
ggatttatgctggctcatccttatggatttacaagaataatgtcaagctaccgttgggca
agaaattttcagaatggaaaagatgttaatgattggattgggccaccaaataataatggc
gtgattaaagaagttactattaatccggacactacttgtggcaatgactgggtctgtgaa
caccgatggcgtcaaataaggaacatggttgcgttccgtaatgtagttaatggccaacct
tttacaaactggtgggataatggtagcaaccaagtagcttttggaagaggaaacagagga
ttcattgtctttaacaatgatgactgggcattgtcttcaactttgcaaactggtcttcct
ggcggcacatattgtgatgttatttctggagataaaattaatggcaattgtacaggaatt
aaaatcaatgtttccagtgatggcaaagcttacttttctattagtaacactgctgaagat
ccatttattgcaattcatgctgaatcaaaattgtaa

DBGET integrated database retrieval system