KEGG   Equus asinus (ass): 106828311
Entry
106828311         CDS       T04645                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
eai  Equus asinus (ass)
Pathway
eai01521  EGFR tyrosine kinase inhibitor resistance
eai04010  MAPK signaling pathway
eai04012  ErbB signaling pathway
eai04014  Ras signaling pathway
eai04151  PI3K-Akt signaling pathway
eai04915  Estrogen signaling pathway
eai05200  Pathways in cancer
eai05210  Colorectal cancer
eai05211  Renal cell carcinoma
eai05212  Pancreatic cancer
eai05214  Glioma
eai05215  Prostate cancer
eai05223  Non-small cell lung cancer
eai05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106828311 (TGFA)
   04012 ErbB signaling pathway
    106828311 (TGFA)
   04014 Ras signaling pathway
    106828311 (TGFA)
   04151 PI3K-Akt signaling pathway
    106828311 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    106828311 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106828311 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106828311 (TGFA)
   05212 Pancreatic cancer
    106828311 (TGFA)
   05225 Hepatocellular carcinoma
    106828311 (TGFA)
   05214 Glioma
    106828311 (TGFA)
   05211 Renal cell carcinoma
    106828311 (TGFA)
   05215 Prostate cancer
    106828311 (TGFA)
   05223 Non-small cell lung cancer
    106828311 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106828311 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 106828311
NCBI-ProteinID: XP_014692175
LinkDB
Position
Un
AA seq 160 aa
MVPSAGQLALFALGVLSAVCQALENTTSALSADPPVAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSVVALAVLIIACVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtgttttgtcggctgtgtgc
caggccctggagaacaccacgtccgccctgagtgcagacccaccggtggccgcagctgtg
gtgtcccattttaatgactgcccggattcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctggatatgttggtgca
cgctgtgagcacgcagacctcctggccgtggtggccgccagccagaagaagcaggccatc
accgccttggtggtggtctccgtcgtggccctggctgtcctcatcatcgcatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagtgccctcctgaagggaaggactgcttgctgccactccgaaacagtggtc
tga

DBGET integrated database retrieval system