KEGG   Equus asinus (ass): 106829071Help
Entry
106829071         CDS       T04645                                 

Gene name
FABP3
Definition
(RefSeq) fatty acid binding protein 3
  KO
K08752  fatty acid-binding protein 3, muscle and heart
Organism
eai  Equus asinus (ass)
Pathway
eai03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:eai00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106829071 (FABP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eai04147]
    106829071 (FABP3)
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   106829071 (FABP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7
Motif
Other DBs
NCBI-GeneID: 106829071
NCBI-ProteinID: XP_014693448
LinkDB All DBs
Position
Un
AA seq 150 aa AA seqDB search
MVDAFVGTWKLVDSKNFDDYMKSIGVGFATRQVANMTKPTTIIEVNGDTITIKTHSTFKN
TEISFKLGVEFDETTADDRKVKSLVTLDGGKLVHVQKWNGQETTLVRELIDGKLILGQTW
GLHSENVALTEHPQTQGQRQQPPAVCLLNL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgccttcgtcggcacctggaagctagtggacagcaagaatttcgatgactac
atgaagtcaatcggtgtgggttttgctaccaggcaggtagccaacatgaccaagcctacc
acaatcatcgaagtaaatggggacactatcaccataaaaacacacagcaccttcaagaac
acggagatcagcttcaagctgggggtggagtttgacgagacaacagcagatgacaggaag
gtcaagtcccttgtgacactggatggaggcaaacttgtccatgtgcagaagtggaatggg
caagagacaacactcgtgcgggagctaattgatggaaaactcatcctgggacaaacttgg
ggacttcactcagagaatgtagccttgactgaacacccccagacccaggggcagagacag
cagccacctgcagtctgcctcctaaatctgtaa

DBGET integrated database retrieval system