KEGG   Equus asinus (ass): 106829693Help
Entry
106829693         CDS       T04645                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
eai  Equus asinus (ass)
Pathway
eai00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106829693 (SETDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eai03036]
    106829693 (SETDB2)
Enzymes [BR:eai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106829693 (SETDB2)
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106829693 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106829693 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD
Motif
Other DBs
NCBI-GeneID: 106829693
NCBI-ProteinID: XP_014694432
LinkDB All DBs
Position
Un
AA seq 704 aa AA seqDB search
MGERNGDAKTFWMELEDDGKVDVIFEQVQNVLQSLKQKIKDGSATNKEYVQAMILVNEAT
ISKNSTLVKDHTSVTQNEQENKSISLPSTSHEDSFPEYCTFLFPQNKEISPLENRVANFR
KKESSSNLSYQSHDCSGACLKKMPLTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVES
VPISFCNEIDNRKLPLFKYRKTMWPRAYYLNSFSNMFTDSCDCSEGCIDITKCACLQLTA
RNAKTCPLSSNKITTGYKYKRLQRQIPTGIYECSLLCKCNRQMCQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDRGTFVCIYSGRLLSRSNTEKSDAIDENGKEENIMKNMFSKKRKI
EVADCEVEVIPLELETHPRSAETETCPPRLSNNLKQPVPEMKCNNTSRIQYHSVIRSPKA
KTAFIQRNGEKMGFTSSDFVASEDDGFKPTQVHLNSKAMETKKDSSSNQIEDSEDNLLIE
SDVIDITKGREETPPGGRCNQATTLDNQNIIKEFEVQIQKPQEEKSPACQNQLVFCDKEL
PSETKNTSSDSLKKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDKNFPLV
AFFTNRYVKARTELTWDYGYEAGTMPEKEILCQCGVNKCRKKIL
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaagaaatggtgatgcaaaaactttctggatggagctggaagatgatggaaaa
gtggacgtcatatttgaacaagtgcaaaatgtgctgcagtcactgaaacaaaagatcaaa
gatgggtctgccacaaataaagaatacgttcaagcaatgattctagtgaatgaagcaact
ataagtaagaattcaacattggtaaaggatcatacatctgtgacccaaaatgaacaggaa
aacaaatcaatttcattgccgtctacatcccatgaagactcctttccagaatactgtaca
tttctattcccccaaaataaggaaatttctcctctggaaaatagagttgcaaactttaga
aaaaaagagtcatcttcgaatttatcttaccaaagtcatgactgctctggtgcctgtctg
aagaaaatgccactaaccttcaagggagaaaaccctctgcagctgccaatcaaatgccac
ttccaaagacgacatgcgaagacaaactctcattcttcggcactccatgtgagttataaa
accccttgtggaaggagtctacgaaacgtggaggaagtttttcgttacctgcttgagaca
gaatgtaactttttatttacagataacttttctttcaatacctatgttcagttgactcga
aattacccaaagcaagaagaaattgtttctgatgtggatattagcaatggagtggaatcg
gtgcccatttctttctgtaatgaaattgacaatagaaagcttccactgtttaagtacaga
aagactatgtggccacgagcatattatctaaacagcttttccaacatgtttactgattca
tgtgactgttctgagggctgcatagacataacaaaatgtgcatgtcttcaactgacagca
aggaatgccaagacttgccccttgtcaagtaataaaataaccactggatataaatataaa
agactacagagacaaatacctactggcatttatgaatgcagcctattgtgcaagtgtaat
cgacaaatgtgtcaaaaccgagttgtccagcatggacctcaagtgaggctgcaggtattc
aaaactgaaaagaaaggatggggagtacgctgcctagatgacatcgacagaggaacattt
gtttgcatttattcaggaagattactaagcagatctaacactgagaaatctgatgctatt
gatgaaaatggaaaagaagagaatattatgaaaaatatgttttcaaaaaagaggaaaata
gaagttgcagattgtgaggttgaagttatccctttagaattggaaacacatcctagaagt
gctgagactgagacctgtccacctaggttgagtaataatctgaaacagcctgttccagaa
atgaaatgtaacaatacttcaagaattcaatatcattcagtcattagaagtcctaaagcc
aagacagcctttattcaacgcaatggggaaaagatgggatttacttcctcagactttgtt
gcctcagaagatgatggatttaaaccaacccaagtacatctgaactctaaagccatggaa
acgaaaaaggactcaagctcaaaccaaattgaagattccgaagacaatctgctgattgaa
tcagatgtgatagatataactaaaggtagagaagaaactccaccagggggcagatgtaac
caagcaaccacattggataatcagaatattataaaggagtttgaggttcaaatacaaaag
ccccaagaggaaaaatctccagcatgtcaaaaccagctggtcttttgtgataaagagttg
ccaagtgaaaccaagaatacttcatctgattctctaaagaagttcaataaagggaatgtg
tttttattggatgccacaaaagaaggaaatgtgggccgcttccttaatcatagttgttgt
ccaaatcttttggtacagaatgtttttgtagaaacacatgataagaattttccactggtg
gcgttcttcactaacaggtatgtgaaagccagaacagagctaacttgggattatggttat
gaagctgggactatgcctgagaaagaaatcctctgccaatgtggggttaataaatgtaga
aagaaaatattataa

DBGET integrated database retrieval system