KEGG   Equus asinus (ass): 106830317Help
Entry
106830317         CDS       T04645                                 

Gene name
ACOX1
Definition
(RefSeq) acyl-CoA oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
eai  Equus asinus (ass)
Pathway
eai00071  Fatty acid degradation
eai00410  beta-Alanine metabolism
eai00592  alpha-Linolenic acid metabolism
eai00640  Propanoate metabolism
eai01040  Biosynthesis of unsaturated fatty acids
eai01100  Metabolic pathways
eai01200  Carbon metabolism
eai01212  Fatty acid metabolism
eai03320  PPAR signaling pathway
eai04024  cAMP signaling pathway
eai04146  Peroxisome
Module
eai_M00087  beta-Oxidation
eai_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    106830317 (ACOX1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106830317 (ACOX1)
   00592 alpha-Linolenic acid metabolism
    106830317 (ACOX1)
   01040 Biosynthesis of unsaturated fatty acids
    106830317 (ACOX1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106830317 (ACOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    106830317 (ACOX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106830317 (ACOX1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106830317 (ACOX1)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     106830317 (ACOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 106830317
NCBI-ProteinID: XP_014695352
LinkDB All DBs
Position
Un
AA seq 661 aa AA seqDB search
MNPDLLRERAAASFNPELLTQILDGSPENTRRRREIENLILKDPDFQHEDLNFLTRSQRY
EVAVRKSANMVKKMREFGIADPDEIMWFKNFVHRGRPEPLDLHLGMFLPTLLHQATEEQQ
ERFFIPAWNLEMIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGL
GKTSNHAIVLAQLITKGKCYGLHAFMVPIREIGTHKPLPGITVGDIGPKFGYDEMDNGYL
KMDNYRIPRENMLMKYAQVKPDGTYVKPVSNKLTYGTMVFVRSFLVGEAARSLSKACTIA
IRYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYLRINEGIG
QGDLSELPELHALTAGLKAFTSWTSNAAIEACRMACGGHGYSHCSGLPNIYVTFTATCTF
EGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPSVVDINSP
DSLTEAYKLRAARLVEIAAKNLQTEVFHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFA
EKLLTIQDKSVQAVLRNLCLLYSLYGISQNAGDFLQGSIMTESQITQVHQRVKELLTAIR
PDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHDSYYKHLKPLQSK
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggacctgctcagggagcgggccgccgccagcttcaacccggagctgctcacg
caaatcctggacggcagccccgagaacacccggcgccgccgggagatcgagaacctgatt
ctgaaagaccccgacttccagcatgaggacttgaactttctcactcgcagccagcgttac
gaggtggctgtgaggaagagtgccaacatggtgaagaagatgagggagtttggcatcgca
gatcctgatgaaatcatgtggtttaaaaattttgtgcaccgagggcggcctgagcctctg
gatcttcacttgggcatgttcttgcccaccttgcttcaccaggcaaccgaggaacagcag
gagcgcttcttcatccccgcctggaacttggagatgattggcacttatgcccagacagag
atgggtcatggaactcatcttcgaggcttggaaaccacagccacttatgatcctgaaacc
caggagttcattctcaacagtcctactgtgacctccatcaaatggtggcctggtgggctt
ggaaagacttcaaatcatgcaatagttcttgcccaactcatcactaaggggaaatgctat
ggattacatgccttcatggtacctattcgtgaaattgggacccataagcctttgccaggc
attaccgttggagacattggccccaaatttggctatgatgagatggataatggctacctg
aagatggacaattatcgtattcccagagaaaacatgctaatgaagtatgcccaggtgaag
cctgatggcacatacgtgaaacctgtgagtaacaagctgacctatgggaccatggtattt
gtcaggtcctttctcgtgggagaagctgctcggtctctgtctaaggcttgcaccattgcc
atccgatacagcgccgtgaggcaccagtctgaaatcaagccaggtgaaccagaaccgcag
attttggattttcaaacccagcagtataaactctttccactcctggctactgcctatgcc
ttccagtttgtaggcgcatacatgaaggagacctatcttcggattaatgaaggcattggc
caaggggacctgagtgaattgccagagcttcacgcactcaccgccgggctgaaggctttc
acctcctggacaagtaacgctgctattgaagcatgtcgcatggcttgtggcggtcatggc
tattctcattgcagtggtcttccaaatatttacgtcacttttactgcaacgtgcaccttt
gagggagaaaatactgtcatgatgctgcagacagctaggttcctgatgaaaagttacgac
caggtgcactcaggaaagttggtgtgtggcatggtgtcctacttgaatgacctacccagt
cagcgcatccagccccagcaggtagctgtctggccgagtgtggtggatatcaacagccct
gacagcctaacagaagcgtataaactccgtgcggccagattagtagaaattgctgcgaaa
aaccttcaaactgaagtgtttcaccgaaaaagcaaggaggtagcatggaacctaacttcc
gttgaccttgttcgagcaagtgaggcacattgccactatgtggtagtgaagctctttgca
gaaaaacttctcacgattcaagataaatccgtccaggctgtcttaaggaatttatgtctc
ttgtattctctatatggaatcagtcagaatgcaggggattttcttcaggggagcatcatg
actgagtctcaaattacccaagtacaccagcgcgtaaaggagttgctgactgccattcgc
cctgatgctgttgctttggtcgatgcttttgattttcaggatgtgacacttggctctgtg
cttggccgctacgacgggaatgtgtatgaaaacttgtttgagtgggccaagaaatctccc
ctgaacaaaacagaggtccatgactcttactacaagcacctgaagccactgcagtccaag
ctctga

KEGG   Equus asinus (ass): 106840065Help
Entry
106840065         CDS       T04645                                 

Gene name
ACOX3
Definition
(RefSeq) acyl-CoA oxidase 3, pristanoyl
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
eai  Equus asinus (ass)
Pathway
eai00071  Fatty acid degradation
eai00410  beta-Alanine metabolism
eai00592  alpha-Linolenic acid metabolism
eai00640  Propanoate metabolism
eai01040  Biosynthesis of unsaturated fatty acids
eai01100  Metabolic pathways
eai01200  Carbon metabolism
eai01212  Fatty acid metabolism
eai03320  PPAR signaling pathway
eai04024  cAMP signaling pathway
eai04146  Peroxisome
Module
eai_M00087  beta-Oxidation
eai_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    106840065 (ACOX3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106840065 (ACOX3)
   00592 alpha-Linolenic acid metabolism
    106840065 (ACOX3)
   01040 Biosynthesis of unsaturated fatty acids
    106840065 (ACOX3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106840065 (ACOX3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    106840065 (ACOX3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106840065 (ACOX3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106840065 (ACOX3)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     106840065 (ACOX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 106840065
NCBI-ProteinID: XP_014710685
LinkDB All DBs
Position
Un
AA seq 703 aa AA seqDB search
MASSSEGSGDALLPDFPRGPLQAYRARASFSWKELALFLEGEDMLRLKKTIFSALEDDPL
FARPGGGDLPMEKYRELNFLRCRWVFEHDLLRVEDMLQSPLKVRALVNCLGMYDWSLAAK
FFLHMLVFGSAIYNSGSERHFKYIPKIFNMEIFGCFALTELSHGTNTKAIRTTAHYDPTT
EEFIIHSPDFEAAKFWVGNMGKTATHAVVFAQLHTPGGGCHGLHAFVVQIRDPKTLLPMP
GVMVGDIGKKLGQNGLDNGFAMFHQVRIPRQDLLNRAGDVTPEGTYVTPFKDDRQRFGMS
LASLSSSRVSIVGMSVVNLKLAVSIAIRFSATRRQFGPTDEEEIPVLEYQMQQWRLLPYL
AAAYALDHFSKSLFLDLAELQQGWLGKDTSARQAELGREIHALASASKPLASWTAQRGIQ
ECREACGGHGYLAMNRLGHLRDDNDPNCTYEGDNNVLLQQTSNYLLSLLTRRTHGGAHCK
SPLKTVDFLEAYPDILGQRFEVPSLEDCLDSSVPLAAYEWLVCYLLRESDQKLNQEKRSG
SNDFEARNNCQVYYCRSLALAFLELTVVRRFHEHTHQPSVPPPLRAVLRRLSALYGLWSL
SQHTALLYRGGYFSGEQAGKMIETAILDLCSQLKDDAVALVDVIAPPDFVLDSPIGRADG
EGLCTCCSCYLECFCSVGSKENTSSSERSSLASTKVPPLCPAV
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctcttcggaaggaagtggcgatgccctgctgccagattttcccagggggccc
ctgcaggcctaccgtgcccgcgcctccttcagctggaaggagctggcgctgttcctggaa
ggcgaggacatgctgcgccttaagaaaactatcttctcggctctggaggacgaccccctc
ttcgcacgtcccggtggaggtgacctcccgatggagaagtaccgggagctgaacttcctg
cgctgcagatgggtcttcgagcacgacttgctccgcgtggaagacatgctccagagcccc
ctgaaagtccgggcgctggtcaactgcctgggcatgtacgactggtccctggctgccaag
tttttcctgcacatgctggtttttggatcagccatttacaactctggttctgaaagacat
ttcaaatatattccgaagatcttcaacatggagatttttggatgttttgctttaactgaa
ctgagtcacgggactaacaccaaggccatccggactaccgctcactacgaccccaccacc
gaggaattcatcatacattcccccgatttcgaagctgccaaattttgggtcggcaacatg
ggcaagactgctacgcatgcggtggtgttcgcacagctgcatacgccggggggcggctgc
cacggcctgcatgccttcgtggtacagattcgggacccgaagaccctcctccccatgccg
ggggtgatggttggtgacatcgggaagaagctggggcagaacggtctggacaatgggttc
gccatgttccaccaggtgagaatccctcgccaggacctcctgaaccgggctggagacgtc
acccctgagggcacctatgtcaccccctttaaggacgacaggcagcgcttcggaatgtcc
ctggctagcttgtcctccagccgcgtctccatcgtgggcatgtccgttgtcaatctgaag
ctggccgtgtccatagccattcgcttctctgccactcggcgtcagtttgggccgacagac
gaggaggaaataccggttctcgagtatcaaatgcagcaatggcgcctcctcccgtatctg
gcagctgcctacgccttagaccacttttccaaatcgctcttcctggacctggcggagctt
cagcaaggctggctgggcaaggacacaagtgccaggcaggcagagctcggacgtgagatc
cacgccttggcgtcggccagcaagcccctggcctcgtggaccgcccagcggggcattcag
gaatgccgagaggcgtgtggaggacacggctacctggccatgaaccggctgggccacctc
cgagatgacaatgatccgaactgcacgtacgaaggtgacaacaacgtcctgctgcagcag
accagcaactacctgctcagcctgctgacccgccggacccacggtggtgctcactgcaag
agccctctgaagactgtggactttctggaagcctaccccgacatccttggccagaggttc
gaggtgcccagccttgaggactgcctggactcctcagtccccctggcagcgtatgagtgg
ttggtctgttacctgctccgagagagtgaccaaaagttaaatcaggagaaaagatcagga
agcaacgactttgaagcaagaaacaactgtcaggtgtattactgccgctccttggcactg
gcgttcctggagctcactgtggtgcggaggttccacgagcacacgcaccagcccagcgtg
ccgcccccgctgcgggccgtgctccggcggctcagcgcactctatggcctgtggtccctg
agccagcacaccgccctgctctaccgaggtggctacttttctggggagcaagcgggtaaa
atgatcgagacggccatcttggacctgtgttcccagctgaaagatgatgcggttgccctg
gtggacgtgatcgcccctcctgactttgtcctggactcaccgattggcagagccgacggc
gagggcctttgcacctgctgttcctgctacctggagtgcttctgttcggttgggtctaag
gagaatacatcctcttcagagaggtcttctctggcctccactaaagtgcccccactttgt
cctgctgtgtga

KEGG   Equus asinus (ass): 106848667Help
Entry
106848667         CDS       T04645                                 

Gene name
ACOX2
Definition
(RefSeq) acyl-CoA oxidase 2
  KO
K10214  3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase [EC:1.17.99.3]
Organism
eai  Equus asinus (ass)
Pathway
eai00120  Primary bile acid biosynthesis
eai01100  Metabolic pathways
eai03320  PPAR signaling pathway
eai04146  Peroxisome
Module
eai_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    106848667 (ACOX2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106848667 (ACOX2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106848667 (ACOX2)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.3  3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase
     106848667 (ACOX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 106848667
NCBI-ProteinID: XP_014724220
LinkDB All DBs
Position
Un
AA seq 680 aa AA seqDB search
MGSPVHRVSMGDTWSRQVHPDIESERYKQTFDVERLTNILDGGAQDTALRRKVESIIHSD
PEFSLKDNYFLTQSECYEAAVEKKFHLQMLAQRQGWAEDSREAYYAYRTLSGSLGFSLQH
IFLKALRSLGSEEQIAKWVPVCNKFQIIGTYAQTELGHGTYLQGLETEATYDAATQEFVV
HSPTMTAIKWWPGDLGRSATHALVQAQLICSGARQGIHAFIVPIRSLQDHTPLPGITVGD
IGPKMGLDHVDNGFLQLDHVRVPRENMLSRFAQVLPDGTYIKLGTAQSNYLSMVVTRVEL
LPGITAELQKACVIAIRYSIIRHQSRLRPSEPEAKILDYQTQQQTLLPQLATAYAFHFLA
RSLLEFLHDSHDAILDRDFSLLPELHALSAGLKAMVSDFCTYGAELCRRACGGHGYSKLS
GLPSLVTKVTASCTFEGENTVLYLQMARFLVKSYQRTQVSLGPTLQRSLPQSVAYLTAPD
LARCPAQRAADFLHPELYTMAWAHVAARLTKDSVHHIQTLMRSGADEHEAWNRTTVIHLQ
AAKAHCYYVTVKSFTEALEKLESEPAVRQVLRRLCDLYALHGILTNTGDFLHDGFLSGAQ
VDMARTAYLDLLLLVRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFDWAQKSPSNTQ
ENPAYEKYIRPLLQSCRSKL
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcccagtgcaccgagtgtcaatgggggacacctggagcaggcaagtgcacccc
gacatagagagtgaaaggtacaagcaaaccttcgacgtggagcggctcaccaacatcctt
gatggaggggcccaggacactgcactccggaggaaagtcgagagcatcatccacagtgac
ccagagtttagcctgaaggacaattatttcctgacccagagtgaatgttatgaggccgcc
gttgagaagaaattccacttgcagatgctagcacagcgccagggctgggcagaagacagt
cgtgaagcatattacgcttacagaaccctttctggaagtctgggcttcagtttgcagcac
atcttcctaaaagccctcaggagcctgggctcagaggagcagattgctaaatgggtccca
gtgtgcaacaagttccagatcatcgggacgtacgcccagacagaactgggacatgggaca
tatctccagggcttggagactgaagccacctacgatgcagccacccaggagtttgtggtg
cacagccccacaatgactgccatcaaatggtggcctggggacctgggacggtcagccacc
catgccctggtccaggcccagctgatctgctcgggagcccggcagggcattcacgccttt
atagtacccatccggagcctccaggaccacactccactgccaggaatcactgttggagac
attgggcccaagatgggccttgaccatgtagacaatggcttcctgcaactggaccacgtg
cgggtccccagggagaacatgctgagccgctttgcacaggtcttgccagatggcacctac
atcaagctcggaacagcacagagcaactacctttccatggtggtgacgcgggtggagctg
ttaccaggcatcacagccgagctgcaaaaggcttgtgtcatcgccattcgctactccatc
atacgccaccagtcccggctccggcccagtgagccagaggcgaaaatcctggactaccag
acgcagcagcagacgctccttcctcagctggcaacagcctatgccttccatttcctggcg
agaagcctcttggaattcttgcatgactcccacgatgccattctggacagggacttcagc
ctcctgcctgagcttcacgcactgagtgcaggtttaaaggccatggtgtcggacttctgc
acttatggggccgagctgtgccgcagggcctgcggtggacatggctactcaaagctgagc
ggcctgccatcgctggtcaccaaagtgacagcctcctgcacctttgagggtgagaacacc
gtgctttacctacagatggccaggtttttggtgaagagctaccagcgaactcaggtgtcc
ctgggccccactctgcagaggtctctccctcagtctgttgcatacctgaccgcacctgac
ctggccaggtgtccggcccagagggcagccgacttcctccacccagagctctataccatg
gcctgggcacacgtggcagccaggctcacaaaggactcagtgcatcacatacagactctg
atgcgatccggggcggacgagcacgaggcctggaacagaaccactgtcatacaccttcag
gctgctaaggcacactgctactacgtcaccgtgaagagttttacagaagctctggagaaa
ctagagagtgaaccagcagtgcggcaggtgctcagacgcctgtgtgatctctatgctctt
catggcatcctgactaacacgggcgactttctccacgatggcttcctgtctggggcccaa
gttgacatggcgagaacagcctatctggacctgctcctccttgtccggaaggatgccatc
ttgttaactgatgcttttgacttcaccgatcagtgcttaaattcagcacttggctgttac
gatggaaatgtctatgaacgtctgttcgattgggctcagaagtcaccaagcaatactcag
gagaaccctgcctatgagaaatatataagaccactactacaaagttgcagatccaagcta
tga

DBGET integrated database retrieval system