KEGG   Equus asinus (ass): 106830734
Entry
106830734         CDS       T04645                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
eai  Equus asinus (ass)
Pathway
eai04014  Ras signaling pathway
eai04390  Hippo signaling pathway
eai04392  Hippo signaling pathway - multiple species
eai05200  Pathways in cancer
eai05206  MicroRNAs in cancer
eai05219  Bladder cancer
eai05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106830734 (RASSF1)
   04390 Hippo signaling pathway
    106830734 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    106830734 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106830734 (RASSF1)
   05206 MicroRNAs in cancer
    106830734 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    106830734 (RASSF1)
   05223 Non-small cell lung cancer
    106830734 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1
Other DBs
NCBI-GeneID: 106830734
NCBI-ProteinID: XP_014696006
LinkDB
Position
Un
AA seq 437 aa
MSAEPELIELRELTPERRAGPGRTRLERANALRIAPGTARNPARQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGRRAQGPAVRALQVHLPLPMPRARPPGLLRAPGPGMGTGAGAGHKRV
LTVEARTLVPAHAHTDTRAHAHTRLGRWLEATGSHDSGSWRAGAAMGEADAGTPSFEMTW
SSTTSSGYCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETPDLSQAEIEQKIKEYN
GQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTAVRRRTS
FYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLSDDE
QPLQLRLLAGPNEKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKY
SYCRQKIQEALHACPLG
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgtccgctgagcctgagctcattgagctgcgagaactgacacccgagcggcgcgccggc
ccgggccgcacccggctggagcgcgccaacgcgctgcgcatcgcgccgggcaccgcgcgc
aacccagcgaggcagctggtcccaggccgcggccaccgcttccagcctgcggggcccgcc
acgcacacgtggtgcgacctctgcggcgacttcatctgggggcgtcgtgcgcaagggcct
gcagtgcgcgcattgcaagttcacctgccactaccgatgccgcgcgctcgtccgcctgga
ctgctgcgggccccgggacctgggatgggaaccggcgctggagcgggacacaaacgtgtg
ttaacggttgaggcgcggacactggtcccggcgcacgcgcacactgacacgcgcgcgcac
gcgcacacgcgcctggggcggtggttggaggctaccggctcacacgactcagggagctgg
cgggcgggcgcggcgatgggcgaggcggacgcagggacgccttctttcgagatgacctgg
agcagcacgacaagcagtggctactgcagccaggaggactcggactccgagctcgagcag
tacttcacggcgcgtacctcgctggcgcggaggccgcgccgggaccaggacgagcctgtg
gagtgggagacacctgacctttctcaggctgagattgagcagaagatcaaggagtacaat
ggccagatcaacagcaacctcttcatgagcctgaacaaggatggctcctacacaggcttc
atcaaggttcaactgaagctagtgcgccctgtctcagtgccctccagcaagaagccaccc
tccttgcaggatgcccggcggggcccagggcgtggcacagctgtgaggcgccgcacttcc
ttctacctccccaaggatgctgtcaagcacctgcatgtgctgtcacgcacacgggcacgc
gaggtcattgaggctctgctgcgcaagttcttggtggtagatgacccccgcaagtttgca
ctctttgagcgggctgagcgccatggccaagtgtacctccggaagctgtctgatgatgag
cagcccctgcaactgcggctccttgcagggcccaatgagaaagccctaagctttgtcctg
aaggagaatgactctggggaggtgaattgggacgccttcagcatgcctgaactacacaac
ttcctacgcatcctgcagcgggaggaagaagaacacctccgccagatcctgcagaagtac
tcctattgtcgccagaagatccaggaggccctgcatgcctgccccctggggtga

DBGET integrated database retrieval system