KEGG   Equus asinus (ass): 106830958Help
Entry
106830958         CDS       T04645                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
eai  Equus asinus (ass)
Pathway
eai00350  Tyrosine metabolism
eai01100  Metabolic pathways
Module
eai_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106830958 (GSTZ1)
Enzymes [BR:eai01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     106830958 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C Glutaredoxin GST_C_2
Motif
Other DBs
NCBI-GeneID: 106830958
NCBI-ProteinID: XP_014696390
LinkDB All DBs
Position
Un
AA seq 217 aa AA seqDB search
MTESGKPILYSYFRSSCSWRVRIALALKSIDYETIPINLIKDGGQQFSEEFQKLNPMKQV
PALKIDGTIIGQSLAIIEYLEETRPTPRLLPQDPKKRAHVRMISDLIASGIQPLQNLSVL
KEVGQENQLTWAQEAINFGFNALEQILQTTAGKYCVGNEVSMADLCLVPQVANAERFKVD
LTPYPTISRINKSLLALEAFQVSHPCRQPDTPPELRA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtctggcaagcctatcctctattcctatttccgaagctcctgctcatggaga
gttcgaattgctctggccttgaaaagcattgactatgaaacgatacccatcaacctcata
aaggatgggggacaacagttctctgaggaattccagaaactgaatcccatgaagcaggtg
ccggccctcaagattgatgggaccatcattggccagtcactggccatcattgagtacctg
gaggagactcggcccactccgcgactcctgcctcaggacccaaagaagagggcccacgtg
cgcatgatttccgacctcatcgccagcggcatccagcctctgcagaacctgtctgtcctg
aaggaagtgggacaggagaaccagctgacctgggcccaggaggccatcaattttggcttt
aatgctctggagcagatcctgcagaccacagcggggaagtactgtgtgggaaatgaggtg
tccatggctgatctgtgcttagtgcctcaggtggcaaatgctgaaaggttcaaggtggat
ctcactccctaccctaccatcagccgcatcaacaagtcgctgctagccttggaggccttc
caagtgtctcacccctgccggcagccggatacaccccctgagctgagagcctag

DBGET integrated database retrieval system