KEGG   Equus asinus (ass): 106830994
Entry
106830994         CDS       T04645                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
eai  Equus asinus (ass)
Pathway
eai04010  MAPK signaling pathway
eai04060  Cytokine-cytokine receptor interaction
eai04068  FoxO signaling pathway
eai04144  Endocytosis
eai04218  Cellular senescence
eai04350  TGF-beta signaling pathway
eai04380  Osteoclast differentiation
eai04390  Hippo signaling pathway
eai04520  Adherens junction
eai04659  Th17 cell differentiation
eai04926  Relaxin signaling pathway
eai04933  AGE-RAGE signaling pathway in diabetic complications
eai05142  Chagas disease
eai05161  Hepatitis B
eai05166  Human T-cell leukemia virus 1 infection
eai05200  Pathways in cancer
eai05202  Transcriptional misregulation in cancer
eai05210  Colorectal cancer
eai05212  Pancreatic cancer
eai05220  Chronic myeloid leukemia
eai05225  Hepatocellular carcinoma
eai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106830994 (TGFBR2)
   04350 TGF-beta signaling pathway
    106830994 (TGFBR2)
   04390 Hippo signaling pathway
    106830994 (TGFBR2)
   04068 FoxO signaling pathway
    106830994 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106830994 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106830994 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    106830994 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106830994 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    106830994 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    106830994 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106830994 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106830994 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    106830994 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106830994 (TGFBR2)
   05212 Pancreatic cancer
    106830994 (TGFBR2)
   05225 Hepatocellular carcinoma
    106830994 (TGFBR2)
   05226 Gastric cancer
    106830994 (TGFBR2)
   05220 Chronic myeloid leukemia
    106830994 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106830994 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106830994 (TGFBR2)
   05161 Hepatitis B
    106830994 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    106830994 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eai01001]
    106830994 (TGFBR2)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     106830994 (TGFBR2)
Protein kinases [BR:eai01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   106830994 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 106830994
NCBI-ProteinID: XP_014696438
LinkDB
Position
Un
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPQVQKSVNNDMMVTDNDGAVKFPQFCKFCNVSSSI
CDNQKSCMSNCSITSRCEKPREVCVAVWRKNDKNITLETVCHDPKLTYHGFVLEDAASPK
CIMKEKKVSGETFFMCSCSSDECNDHIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAI
AVIITFYCYRVHRQQKLSPSWETSKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHMDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccaccgcaagttcagaagtcggttaataatgacatgatggtcactgac
aacgacggtgcagtcaagtttccacaattttgtaaattttgcaacgtgagctcttccatc
tgtgacaaccagaaatcctgcatgagcaactgcagcatcacgtccagatgtgagaagcca
cgcgaagtctgtgtggctgtctggagaaagaatgataagaacataacactagagacggtt
tgccatgaccccaagctcacctaccatggatttgttcttgaagatgctgcttctccaaag
tgtattatgaaggaaaaaaaagtgtctggcgagactttctttatgtgttcctgtagctct
gatgagtgcaacgaccacatcatcttctcagaagaatatgccaccaacaaccctgacttg
ttgttagtcatattccaagtgacaggcgtcagcctcctgccaccgctgggaatcgccatt
gcggtcatcatcaccttctactgctaccgcgttcaccggcagcagaagctgagcccgtcc
tgggagaccagcaagccacggaagctcatggagttcagtgagcaccttgccatcattctg
gaagacgaccgctccgacatcagctctacgtgtgccaacaatatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgctttgctgaggtctacaag
gccaagctgaagcagaacacttcagagcagttcgagaccgtggcagtcaagatctttcct
tatgaggagtacgcctcctggaagacagagaaggacattttttcagacatcaacctgaag
catgagaacatactccagttcctcacagctgaggagcgaaagacagaactgggaaagcaa
tattggctgatcaccgctttccatgccaagggcaacctacaggaataccttacacggcat
gtcatcagctgggaggacctgcgcaagctaggcagctccctagcccggggcattgctcac
ctgcacagtgaccacaccctgtgcgggaggcccaagatgcccattgtgcacagggacctc
aagagctccaacatcctcgtgaagaatgacctgacctgctgcctgtgtgactttgggctt
tccctgcgtttggacccgaccctgtctgtggatgacctggccaacagtgggcaggtggga
actgcaagatacatggccccagaagtcctggagtccaggatgaatttggagaatgttgag
tccttcaagcagacagatgtctactccatggctctggtgctctgggaaatgacatctcgc
tgtaacgcagtgggagaagtgaaagattatgagcctccatttggttccaaggtgcgggag
catccctgtgtcgaaagcatgaaggacaatgtcttgagagatcgaggacgaccagaaatt
cccagctcctggctcaaccaccagggcatccagatggtgtgtgagactctgaccgaatgc
tgggaccacgacccggaggcccgtctcacggcccagtgcgtggcggaacgcttcagcgag
ctggagcacatggacagactctcggggaggagctgctccgaggagaagattcccgaagac
ggctcgctgaacactaccaaatag

DBGET integrated database retrieval system