KEGG   Equus asinus (ass): 106831009
Entry
106831009         CDS       T04645                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
eai  Equus asinus (ass)
Pathway
eai04022  cGMP-PKG signaling pathway
eai04141  Protein processing in endoplasmic reticulum
eai04151  PI3K-Akt signaling pathway
eai04211  Longevity regulating pathway
eai04261  Adrenergic signaling in cardiomyocytes
eai04668  TNF signaling pathway
eai04728  Dopaminergic synapse
eai04911  Insulin secretion
eai04915  Estrogen signaling pathway
eai04918  Thyroid hormone synthesis
eai04925  Aldosterone synthesis and secretion
eai04926  Relaxin signaling pathway
eai04927  Cortisol synthesis and secretion
eai04928  Parathyroid hormone synthesis, secretion and action
eai04934  Cushing syndrome
eai04935  Growth hormone synthesis, secretion and action
eai05020  Prion disease
eai05030  Cocaine addiction
eai05031  Amphetamine addiction
eai05034  Alcoholism
eai05161  Hepatitis B
eai05163  Human cytomegalovirus infection
eai05166  Human T-cell leukemia virus 1 infection
eai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106831009 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    106831009 (ATF6B)
   04022 cGMP-PKG signaling pathway
    106831009 (ATF6B)
   04151 PI3K-Akt signaling pathway
    106831009 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    106831009 (ATF6B)
   04915 Estrogen signaling pathway
    106831009 (ATF6B)
   04926 Relaxin signaling pathway
    106831009 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    106831009 (ATF6B)
   04918 Thyroid hormone synthesis
    106831009 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    106831009 (ATF6B)
   04925 Aldosterone synthesis and secretion
    106831009 (ATF6B)
   04927 Cortisol synthesis and secretion
    106831009 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106831009 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    106831009 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    106831009 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    106831009 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    106831009 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    106831009 (ATF6B)
   05031 Amphetamine addiction
    106831009 (ATF6B)
   05034 Alcoholism
    106831009 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106831009 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106831009 (ATF6B)
   05161 Hepatitis B
    106831009 (ATF6B)
   05163 Human cytomegalovirus infection
    106831009 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eai03000]
    106831009 (ATF6B)
Transcription factors [BR:eai03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106831009 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 106831009
NCBI-ProteinID: XP_014696463
LinkDB
Position
Un
AA seq 703 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDEVAEEQTQLFRCPEQDVPFGS
SSLDVGMDVSPPEPPWDSVPIFADLQVKSEPSSPCSSSSFTSESSRLSTEPSSQGPGVGE
VLVVKTESLAPPLCLLGDDPTSPFETIQINVGPTSDDPSDVQTKIEPVSPSSSINSEASL
LSAESPNQAFIGEEVLEVKTESLSPQGYLLRDVPGPPLGAVQISMGPSPDGSSGKALPTR
KPPLQPKPVVITTVPMPPRAVPASTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGPAPPAP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEGLLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
SAPVSPQMNGEEPRPRRHLLEFSAQEPVHGVEALQGSTQSHEEPQPSPASRPSFRNLTAF
PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQEKQKS
QLRKKSPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSSTPGNATGGPLPASAAGQAHQATHRPLYLNHP
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagattgcggacccgacccgttttttcaccgacaac
ttgctgagcccggaggactggggtctgcggaatagcaccttgtacactggtctggatgaa
gtggccgaggaacagacgcagctcttccgttgcccggagcaggatgtcccgtttggcagc
agctccctggacgtgggaatggatgtcagccccccggaacccccctgggactccgtgcct
atcttcgcagatcttcaggtgaagtctgagccatcttccccctgctcttcctcctccttc
acctctgaatcatcgcgtctttctacggagccctccagccagggtcctggtgtaggggag
gtgctcgttgtgaagacagagtccttggcacctccactctgcctcctaggagatgaccca
acgtccccatttgaaaccatccagatcaatgtgggccccacctctgatgatccctcagat
gtccagaccaagatagagcctgtctctccgtcttcttccatcaactctgaggcttccctg
ctctcagcagagtcccccaaccaggctttcataggagaggaggtactggaagtgaagaca
gagtctctgtcccctcaagggtatctcctgcgggatgtcccaggccccccacttggagct
gtccagatcagcatgggcccgtcccccgatggctcctcaggcaaagccctgcccacgcgg
aagccaccactgcagcccaaacccgtggtgataaccactgtcccaatgccacccagagct
gtgcctgccagcaccactgtccttttgcagccccttgtccagccacccccagtgtcccca
gttgtcctcatccaaggtgctattcgagtccagcctgagggcccagcaccccctgcacca
aggcctgagaggaagagcattgttccagctcctatgcctgggaactcctgtccacctgaa
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggaatcagcctgc
cagtccaggaggaagaagaaagagtatctgcaggggctggaggctcgactgcaggctgtt
ctggccgacaaccaacagctccgccgggagaatgctgccctccggcggcggctggagggc
ctgctggctgagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatc
atggtcttccttctcttcattgccttcaacttcgggcctgtcagcatcagtgagcctcct
tcggctcccgtgtctcctcagatgaacggagaggagcctcgacctcggagacacttgctg
gagttctcagcacaagagccggttcatggagttgaggccctccagggctccactcagagc
catgaggagccccagcccagccccgcaagcaggccaagcttcaggaacctgacagccttc
cctgggggtgccaaggagctgctgctgagagacctggaccagctcttcctctcctctgat
tgccggcacttcaaccgaaccgagtccctgaggcttgctgacgagctgagcggctgggtc
cagcgccaccagagaggccggcggaagatcccccagagggcccaggagaaacagaagtct
cagctacggaagaagtcgcctccagttaaggcagtccccacccaaccccccgggccccca
gaaagggattctgtgggccagctgcagctgtatcgccacccagaccgttcacagccagag
ttcctggatgcaattgaccgacgggaagacacattttatgttgtctccttccgaagggac
cacttgctgctcccagccatcagccacaacaagacctctcggcccaagatgtccctggtg
atgcctgccatggcgcccaacgagaccctgtcaggccggggggccccaggggactatgag
gagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctcc
acagtgcccccctcgctccgaaaacagccgtcctcgaccccaggcaatgccacaggtggc
cccttgccagcttctgcagctggccaggcccaccaggccacccatcggcccctctacctc
aatcatccctga

DBGET integrated database retrieval system