KEGG   Equus asinus (ass): 106831205Help
Entry
106831205         CDS       T04645                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
eai  Equus asinus (ass)
Pathway
eai00561  Glycerolipid metabolism
eai03320  PPAR signaling pathway
eai04979  Cholesterol metabolism
eai05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    106831205 (LPL)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106831205 (LPL)
  09154 Digestive system
   04979 Cholesterol metabolism
    106831205 (LPL)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106831205 (LPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eai04147]
    106831205 (LPL)
   00536 Glycosaminoglycan binding proteins [BR:eai00536]
    106831205 (LPL)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eai00537]
    106831205 (LPL)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     106831205 (LPL)
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   106831205 (LPL)
  Exosomal proteins of breast milk
   106831205 (LPL)
Glycosaminoglycan binding proteins [BR:eai00536]
 Heparan sulfate / Haparin
  Enzymes
   106831205 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eai00537]
 Enzymes
  106831205 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 106831205
NCBI-ProteinID: XP_014696760
LinkDB All DBs
Position
Un
AA seq 471 aa AA seqDB search
MESKALLLVGLGLWLQSLAAADKIIGGRDFRDIESKFALRTPKDTAEDTCHLIPGVTESV
ANCHFNQSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQQHYPVS
AGYTKLVGKDVARFINWMAEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDP
AGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCN
IGEAIRVIAARGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGLCLS
CRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDVHTNQAFEI
SLYGTVAESENIPFTLPEVSINKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSNWWNSP
GFTIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPVVFVKCHDKSLNKKSG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcactgctcctggtgggtctgggcttgtggctccagagtctggccgcc
gccgacaaaattataggaggaagagattttagagacatcgaaagtaaattcgctctgagg
acccctaaagacacagctgaggacacttgccacctcattcctggagtgacagaatctgtg
gctaactgtcacttcaaccaaagcagcaaaacctttgtggtgatccacggctggacggtg
acaggaatgtatgagagttgggtgccaaaacttgtggctgctctgtacaagagggaacca
gactccaatgtcattgtggtggactggctgtcacgggcccagcagcattatccagtgtct
gcggggtacaccaagctggtgggaaaggatgtggcccggtttatcaactggatggcggag
gaatttaactatcctctggacaatgtccatctgttgggatacagccttggagcccatgct
gctggcattgcaggaagtctgaccaataagaaggtcaacagaattactggtctagatcca
gctggccccaactttgagtatgcagaagctccaagtcgcctttcccctgatgatgcggat
tttgtagacgtcttacacacattcaccagaggatcacctggccgaagcattgggatccag
aaaccagtagggcatgttgacatttaccctaatggaggcactttccaaccagggtgtaac
attggggaggctatccgtgtgattgcagcgagaggccttggagatgtggaccaactagtg
aagtgctcccacgagcgctccattcatctcttcattgactctctgttgaatgaagaaaat
ccaagtaaggcttaccggtgtaattcaaaggaagcctttgagaaagggctctgcctgagc
tgcagaaagaaccgttgcaacaacttgggctatgagatcaataaggtcagagccaaaaga
agtagcaaaatgtacctgaagactcgttctcagatgccatacaaagtcttccattaccaa
gtaaagatacatttttctgggactgaaagtgatgtacacaccaaccaggccttcgagatc
tctctgtacggcactgtggccgagagtgagaacatccctttcacactccctgaagtttcc
ataaataagacatactccttcctgatttacacggaggtggatattggagaactgctaatg
ttgaaactcaaatggaagagcgattcatacttcagctggtcaaactggtggaacagccct
ggctttactattcagaagatcagagtaaaagcaggagagactcagaaaaaggtgatcttc
tgctccagggagaaggtgtctcatctgcagaaaggaaaggccccggtggtatttgtgaag
tgccatgacaagtctctgaataagaagtccggctga

DBGET integrated database retrieval system