KEGG   Equus asinus (ass): 106832203Help
Entry
106832203         CDS       T04645                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
eai  Equus asinus (ass)
Pathway
eai04371  Apelin signaling pathway
eai05034  Alcoholism
eai05165  Human papillomavirus infection
eai05169  Epstein-Barr virus infection
eai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:eai00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    106832203 (HDAC4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    106832203 (HDAC4)
  Substance dependence
   05034 Alcoholism
    106832203 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    106832203 (HDAC4)
   05165 Human papillomavirus infection
    106832203 (HDAC4)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106832203 (HDAC4)
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106832203 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 106832203
NCBI-ProteinID: XP_014698328
LinkDB All DBs
Position
Un
AA seq 1077 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVAAALPLQVAPPAVPMDLRLDHQFSLP
VTEPTLREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAP
SSPNNSSGNVSTENGIAPAVPSIPAETSLAHRLVTREASVAPLPLYTSPSLPNITLGLPA
TGPSAGAAGQQEAERLTLPALQQRISLFPGTHLTPYLSTAPLERDGAAAHNPLLQHMVLL
EQPPAQTPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQ
ALQHLVIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQAL
LEEPYRDRLSGQKEAHALAGVQVKQEPIESDDEEAEPPREAEPGQHQPTEQELLFRQQAL
LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTG
LVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVH
SEAHTLLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAV
GCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKTL
IVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFT
GGLDPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGY
LTKQLMGLAGGRIILALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVR
SMEKVIEIHSQYWRSLRRPSSTAGHSLVEAQKCETEEAETVTAMASLSVGVKPAEKR
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aaccctgcccgcgtgaaccacatgcccagcacagtggacgtggccgcggcgctgcctttg
caagtcgcccccccggcggtgcccatggacctgcgcctggaccaccagttttcgctgccc
gtgacggagcccaccctgcgggagcagcagctgcagcaggagctcctggccctcaagcag
aagcagcagctccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcccagctgcacgagcacatcaaacaacagcaggagctgctggcc
atgaagcaccagcaggagctgctagagcatcagcggaagctggagagacaccgccaggag
caggagctggagaagcagcaccgcgagcagaagctgcagcagctcaagaacaaggagaaa
ggcaaagagagtgccgtggccagcacggaagtgaagatgaagttgcaagagtttgtcctc
aacaagaagaaggcgctggcccaccgcaacctgaaccactgcatttccagcgacccccgc
tactggtacgggaaaacgcagcacagttcccttgaccagagctccccgccccagagtggg
gtgtcggcctcctacaaccacccggtcctgggaatgtatgacgccaaagacgacttccct
ctcagaaaaacagcttctgaacccaatctgaagttacggtctaggctaaagcagaaagtg
gccgagagacggagcagccccctgttacgcaggaaagacgggccagtggttactgctctg
aaaaagcgtcccctggatgtcacagactcggcatgcagcagcgccccgggctcggcgccc
agctcgcccaacaacagctccgggaacgtgagcacggagaacgggatcgcgcccgccgtc
cccagcatcccggccgagaccagcttggcgcacagacttgtgactcgggaagcctccgtg
gccccgcttcccctctacacatctccgtccttgcccaacatcaccctgggacttcctgcc
actggcccttccgctggggcagcaggccagcaggaagctgagcgactcactctcccagcc
ctccagcagcggatctccctctttcccggcacccacctcacaccatacctgagcacagcg
cccctggagcgggacggcgcggcggctcacaaccccctcctgcagcacatggtcttactg
gagcagccgcctgcacagacgcccctcgtcacagactggtatctttcaggcctgggagca
ctgcccctgcacgcgcagtctctggttggtgcggaccgggtatccccgtccatccacaag
ctgcggcagcaccgcccgctggggcgcacgcagtcggccccactgccccagaacgcgcag
gccctgcagcacctggtgatccagcagcagcatcagcagttcctggagaagcacaagcag
cagttccagcagcagcagctgcacatgaacaagattatccccaagcccagcgagccggcc
cggcagcccgagagccaccctgaggagacggaggaggagctccgcgagcaccaggccctc
ctggaggagccctaccgggaccggctctccgggcagaaggaggcacacgcgctggccgga
gtgcaggtgaagcaggagcccatcgagagtgacgatgaggaggccgagcccccacgggag
gcggagccgggccagcaccagcctacggagcaggagctgctcttcagacagcaagccctc
ctcctggagcagcagcgcatccaccagctgaggaactaccaggcatccatggaggccgcg
ggcatccccgtgtcctttggcggccaccggcctctgtcccgggcacagtcgtctccagcg
tctgccaccttccccatgtctgtgcaggagccccccaccaagccgaggttcaccacaggc
ctggtgtacgacacgctgatgctgaagcaccagtgcacctgcgggaacactaacagccac
ccagagcacgccgggaggatccagagcatctggtcccggctgcaggagaccggcctccga
ggcaaatgtgagtgcatccgtggacggaaggccaccttggaggagctgcagacggtgcat
tcagaggcgcacaccctgctctacggcacaaaccccctcaacaggcagaaactggacagt
aagaaacttctaggctcactcacttcggtgtttgtcaggctgccctgtggtggtgtcggg
gtggacagcgacaccatatggaacgaggtgcactcgtcaggggcggcccgcctggccgtg
ggctgcgtggtggagctggtcttcaaggtggccacgggggagctgaagaatggctttgcc
gtggtccgccccccgggacatcacgcagaagagagcacacccatggggttctgctacttt
aactctgtggccatcgcagccaagcttctccagcaaaggctgaacgtgagcaagaccctc
atcgtggactgggacgtgcaccacggaaatgggacccagcaggcattctacaacgaccca
aatgtcctgtacatctccctacaccgctacgacgacgggaacttcttcccgggcagcggg
gcgcctgacgaggtgggcacagggccgggcgtgggcttcaacgtcaacatggctttcacc
ggcggcctcgaccccccaatgggagacgcggagtacctggcggccttcagaacggtggtc
atgcccatcgcgaacgagtttgccccggatgtggtgctggtgtcatcaggcttcgacgct
gtggagggccaccccacgccgctcggcggctacaacctctcagccaaatgtttcgggtac
ctgacgaagcagctgatgggcttggctggcggccggattattctggccctggaggggggc
catgacctcacggccatttgcgacgcctcggaagcatgtgtttctgctttgctgggaaac
gagcttgatcctctcccagaaaaggttttacagcagagacccaatgctaacgctgtccgg
tccatggagaaggtcattgaaatccacagccagtactggcgctcgctgcggcggccctcc
tccacggcggggcactcgctcgtcgaggcccagaagtgcgagaccgaggaagccgagacc
gtcaccgccatggcctcgctgtccgtgggcgtgaagccggccgagaagaggtga

DBGET integrated database retrieval system