KEGG   Equus asinus (ass): 106832203Help
Entry
106832203         CDS       T04645                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
eai  Equus asinus (ass)
Pathway
eai04371  Apelin signaling pathway
eai05034  Alcoholism
eai05165  Human papillomavirus infection
eai05169  Epstein-Barr virus infection
eai05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106832203 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    106832203 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    106832203 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    106832203 (HDAC4)
   05165 Human papillomavirus infection
    106832203 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eai03036]
    106832203 (HDAC4)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106832203 (HDAC4)
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106832203 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 106832203
NCBI-ProteinID: XP_014698328
LinkDB All DBs
Position
Un
AA seq 1077 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVAAALPLQVAPPAVPMDLRLDHQFSLP
VTEPTLREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAP
SSPNNSSGNVSTENGIAPAVPSIPAETSLAHRLVTREASVAPLPLYTSPSLPNITLGLPA
TGPSAGAAGQQEAERLTLPALQQRISLFPGTHLTPYLSTAPLERDGAAAHNPLLQHMVLL
EQPPAQTPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQ
ALQHLVIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQAL
LEEPYRDRLSGQKEAHALAGVQVKQEPIESDDEEAEPPREAEPGQHQPTEQELLFRQQAL
LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTG
LVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVH
SEAHTLLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAV
GCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKTL
IVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFT
GGLDPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGY
LTKQLMGLAGGRIILALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVR
SMEKVIEIHSQYWRSLRRPSSTAGHSLVEAQKCETEEAETVTAMASLSVGVKPAEKR
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aaccctgcccgcgtgaaccacatgcccagcacagtggacgtggccgcggcgctgcctttg
caagtcgcccccccggcggtgcccatggacctgcgcctggaccaccagttttcgctgccc
gtgacggagcccaccctgcgggagcagcagctgcagcaggagctcctggccctcaagcag
aagcagcagctccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcccagctgcacgagcacatcaaacaacagcaggagctgctggcc
atgaagcaccagcaggagctgctagagcatcagcggaagctggagagacaccgccaggag
caggagctggagaagcagcaccgcgagcagaagctgcagcagctcaagaacaaggagaaa
ggcaaagagagtgccgtggccagcacggaagtgaagatgaagttgcaagagtttgtcctc
aacaagaagaaggcgctggcccaccgcaacctgaaccactgcatttccagcgacccccgc
tactggtacgggaaaacgcagcacagttcccttgaccagagctccccgccccagagtggg
gtgtcggcctcctacaaccacccggtcctgggaatgtatgacgccaaagacgacttccct
ctcagaaaaacagcttctgaacccaatctgaagttacggtctaggctaaagcagaaagtg
gccgagagacggagcagccccctgttacgcaggaaagacgggccagtggttactgctctg
aaaaagcgtcccctggatgtcacagactcggcatgcagcagcgccccgggctcggcgccc
agctcgcccaacaacagctccgggaacgtgagcacggagaacgggatcgcgcccgccgtc
cccagcatcccggccgagaccagcttggcgcacagacttgtgactcgggaagcctccgtg
gccccgcttcccctctacacatctccgtccttgcccaacatcaccctgggacttcctgcc
actggcccttccgctggggcagcaggccagcaggaagctgagcgactcactctcccagcc
ctccagcagcggatctccctctttcccggcacccacctcacaccatacctgagcacagcg
cccctggagcgggacggcgcggcggctcacaaccccctcctgcagcacatggtcttactg
gagcagccgcctgcacagacgcccctcgtcacagactggtatctttcaggcctgggagca
ctgcccctgcacgcgcagtctctggttggtgcggaccgggtatccccgtccatccacaag
ctgcggcagcaccgcccgctggggcgcacgcagtcggccccactgccccagaacgcgcag
gccctgcagcacctggtgatccagcagcagcatcagcagttcctggagaagcacaagcag
cagttccagcagcagcagctgcacatgaacaagattatccccaagcccagcgagccggcc
cggcagcccgagagccaccctgaggagacggaggaggagctccgcgagcaccaggccctc
ctggaggagccctaccgggaccggctctccgggcagaaggaggcacacgcgctggccgga
gtgcaggtgaagcaggagcccatcgagagtgacgatgaggaggccgagcccccacgggag
gcggagccgggccagcaccagcctacggagcaggagctgctcttcagacagcaagccctc
ctcctggagcagcagcgcatccaccagctgaggaactaccaggcatccatggaggccgcg
ggcatccccgtgtcctttggcggccaccggcctctgtcccgggcacagtcgtctccagcg
tctgccaccttccccatgtctgtgcaggagccccccaccaagccgaggttcaccacaggc
ctggtgtacgacacgctgatgctgaagcaccagtgcacctgcgggaacactaacagccac
ccagagcacgccgggaggatccagagcatctggtcccggctgcaggagaccggcctccga
ggcaaatgtgagtgcatccgtggacggaaggccaccttggaggagctgcagacggtgcat
tcagaggcgcacaccctgctctacggcacaaaccccctcaacaggcagaaactggacagt
aagaaacttctaggctcactcacttcggtgtttgtcaggctgccctgtggtggtgtcggg
gtggacagcgacaccatatggaacgaggtgcactcgtcaggggcggcccgcctggccgtg
ggctgcgtggtggagctggtcttcaaggtggccacgggggagctgaagaatggctttgcc
gtggtccgccccccgggacatcacgcagaagagagcacacccatggggttctgctacttt
aactctgtggccatcgcagccaagcttctccagcaaaggctgaacgtgagcaagaccctc
atcgtggactgggacgtgcaccacggaaatgggacccagcaggcattctacaacgaccca
aatgtcctgtacatctccctacaccgctacgacgacgggaacttcttcccgggcagcggg
gcgcctgacgaggtgggcacagggccgggcgtgggcttcaacgtcaacatggctttcacc
ggcggcctcgaccccccaatgggagacgcggagtacctggcggccttcagaacggtggtc
atgcccatcgcgaacgagtttgccccggatgtggtgctggtgtcatcaggcttcgacgct
gtggagggccaccccacgccgctcggcggctacaacctctcagccaaatgtttcgggtac
ctgacgaagcagctgatgggcttggctggcggccggattattctggccctggaggggggc
catgacctcacggccatttgcgacgcctcggaagcatgtgtttctgctttgctgggaaac
gagcttgatcctctcccagaaaaggttttacagcagagacccaatgctaacgctgtccgg
tccatggagaaggtcattgaaatccacagccagtactggcgctcgctgcggcggccctcc
tccacggcggggcactcgctcgtcgaggcccagaagtgcgagaccgaggaagccgagacc
gtcaccgccatggcctcgctgtccgtgggcgtgaagccggccgagaagaggtga

DBGET integrated database retrieval system