KEGG   Equus asinus (ass): 106832542Help
Entry
106832542         CDS       T04645                                 

Gene name
ADIPOQ
Definition
(RefSeq) adiponectin, C1Q and collagen domain containing
  KO
K07296  adiponectin
Organism
eai  Equus asinus (ass)
Pathway
eai03320  PPAR signaling pathway
eai04152  AMPK signaling pathway
eai04211  Longevity regulating pathway
eai04920  Adipocytokine signaling pathway
eai04930  Type II diabetes mellitus
eai04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    106832542 (ADIPOQ)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106832542 (ADIPOQ)
   03320 PPAR signaling pathway
    106832542 (ADIPOQ)
  09149 Aging
   04211 Longevity regulating pathway
    106832542 (ADIPOQ)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    106832542 (ADIPOQ)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    106832542 (ADIPOQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1q Collagen BclA_C
Motif
Other DBs
NCBI-GeneID: 106832542
NCBI-ProteinID: XP_014698838
LinkDB All DBs
Position
Un
AA seq 239 aa AA seqDB search
MLLLQAVLLLLVLPSPGEVTTTEETLPKGGCAGWMAGIPGHPGHNGTPGRDGRDGTPGEK
GEKGDPGLVGPKGDAGETGVPGVEGPRGFPGIPGRKGEAGESSYVYRSAFSVGLETRVTV
PNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYLKDVKVSLYKKDKAVLFT
YDQYQDKNLDQASGSVLLYLEKGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDAN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgctccaagctgttctattgctactagtcctgccgagtccgggtgaggttacc
acgactgaagagactctgcccaaggggggctgtgcaggttggatggcaggcatcccaggg
catcctggccacaatgggaccccaggccgtgatggcagagatggcacccctggcgagaag
ggtgagaaaggagatccaggtcttgttgggcctaagggtgatgctggtgaaactggagtg
cctggagttgaaggtcccagaggctttccgggaatcccaggcaggaaaggagaagctgga
gaaagttcctatgtataccgctcagcattcagtgtaggattggagacccgagtcaccgtc
cccaatgttcccattcgttttaccaagatcttctacaatcagcaaaaccactatgatggc
agcacgggcaaattccactgcaacattcctgggctgtactacttctcctaccacatcaca
gtctacttgaaggatgtgaaggtcagcctctacaagaaggacaaggctgtgctcttcacc
tatgaccagtaccaggacaagaacttggaccaggcctcaggctctgttctcctctatctg
gagaagggcgaccaagtctggctccaggtgtatggggatggagatcataatgggctctat
gctgataatgtcaatgactccaccttcacaggcttccttctctaccacgacgccaactga

DBGET integrated database retrieval system