KEGG   Equus asinus (ass): 106832715
Entry
106832715         CDS       T04645                                 

Gene name
FN1
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
eai  Equus asinus (ass)
Pathway
eai04151  PI3K-Akt signaling pathway
eai04510  Focal adhesion
eai04512  ECM-receptor interaction
eai04810  Regulation of actin cytoskeleton
eai04933  AGE-RAGE signaling pathway in diabetic complications
eai05100  Bacterial invasion of epithelial cells
eai05135  Yersinia infection
eai05146  Amoebiasis
eai05165  Human papillomavirus infection
eai05200  Pathways in cancer
eai05205  Proteoglycans in cancer
eai05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    106832715 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    106832715 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106832715 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106832715 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106832715 (FN1)
   05205 Proteoglycans in cancer
    106832715 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    106832715 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106832715 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    106832715 (FN1)
   05100 Bacterial invasion of epithelial cells
    106832715 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106832715 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106832715 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eai04131]
    106832715 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eai04147]
    106832715 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:eai00536]
    106832715 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:eai04990]
    106832715 (FN1)
Membrane trafficking [BR:eai04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    106832715 (FN1)
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   106832715 (FN1)
Glycosaminoglycan binding proteins [BR:eai00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   106832715 (FN1)
Domain-containing proteins not elsewhere classified [BR:eai04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   106832715 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF1410
Other DBs
NCBI-GeneID: 106832715
NCBI-ProteinID: XP_014699064
LinkDB
Position
Un
AA seq 2477 aa
MLRGPGPGLLLLVVLSLGTAVPSSGASKRKRQDQQIIQPQSPVAVGQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHASLQTTSTGSGPFTDVRTAIYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDSAVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRV
GDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWKPKNAPGRWKEATIP
GHLNSYTIKGLRPGVVYEGQLISVQHYGHKEVTRFDFTTTSTSPPVTSNTVTGETTPFSP
VVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELTLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTG
VPRADKVPPPRDLQFVEVTDVKITIMWTPPESAVTGYRVDVLPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYHFKIFAVNHGRESKPLTGEQTTKLDAPTNLRFINETESTVVVTWTPP
RARIAGYRLTVGLTRGGQPKQYNVGPSASQYPLRSLQPGSEYTVTLVAVKGNQQSPKATG
VFTTLQSPGSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTISVLRDGQERDAPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTSGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTWAP
PPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHTGGRPREDRVPPS
RNSITLTNLNPGTEYVVSIVALNGREESPPLVGQQSTVSDVPRDLEVIATTPTSILISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISIDYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTTPKNGPGQSKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNQNGESQPLVQTAVTNIDRPRGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTELKFTQVTPTSLTAQWTAPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSTSVVVSGLMVATKYEVSVYALKDTLTSRPAQGIVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQPPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVIIDASTAIDAPSNLHFLATTPNSLLISWQPPRARITGYIIKYEKPGSPPREVVP
RPHPGVTEATITGLEPGTEYTIQVIAIKNNQKSEPLIGRRKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFITNPGYDNGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPV
RHRPRPYPPNVNEEIQIGHVPRGDVDQHLYPHVLGLNPNTSTGQEALSQTTISWTPFQES
SEYIISCHPVGIDEEPLQFRVPGTSASATLTGLTRGATYNIIVEALKDQKRHKVREEVVT
VGNSVDQGLGQPTADSCFDPYTVSHYAIGEEWERLSESGFKLSCQCLGFGSGHFRCDSSK
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGAEPGHEGSTGHSYNQYSQRYQQRTNTNVNCPI
ECFMPLDVQADRDDSRE
NT seq 7434 nt   +upstreamnt  +downstreamnt
atgctcaggggtccgggacctgggctgctgctgctggtcgtcctgtccctggggacagcg
gtgccctccagcggagcctcgaagaggaagaggcaggatcagcaaatcattcagccccag
tccccggtggctgtcggccaaagcaagcctggttgttacgacaatgggaaacactatcag
ataaaccaacaatgggagcgcacctacctgggcaatgccttggtttgtacctgctacgga
gggagcagaggctttaactgcgagagtaaacctgagcctgaagagacttgctttgacaag
tacaccgggaacacttaccgggtcggcgacacttatgagcgccctaaagactccatgatc
tgggactgtacctgcatcggggccggccgagggagaatcagctgcaccattgcaaaccgc
tgccatgaagggggtcagtcctacaagattggtgacacctggaggagacctcatgagact
ggtggttacatgttagagtgtgtctgtcttggtaatgggaaaggagaatggacctgcaag
cctatagctgagaaatgttttgatcatgctgctgggacctcttatgttgtcggggaaacc
tgggagaagccctaccaaggctggatgatggtggactgtacttgtctgggagaaggcaat
gggcgcatcacctgtacctctagaaacagatgcaatgatcaggacactaggacatcctat
agaattggcgatacctggagcaagaaggataatcgggggaacctgctccagtgcatctgc
acaggcaacggcagaggggagtggaagtgtgaaaggcacgcgtctctgcagaccacatcc
accggatctggccccttcacagatgtccgaacggccatttaccagccccagcctcacccc
cagcccgctccatacggtcactgtgtcacagacagtggcgtggtttactccgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctttgcacttgcctgggcaatggagtc
agctgccaagagacagctgtgacccagacttatggtggcaattcaaacggggagccgtgt
gtcttacccttcacctacaacggcagaactttctactcctgtaccacggaggggcggcag
gatggacacctctggtgcagcacaacttccaattatgagcaagaccagaaatattctttc
tgtacagacagtgctgttttggttcagactcgaggtgggaattccaacggtgccttgtgc
cacttccccttcctatacaacaaccacaactacactgactgtacttctgagggcaggaga
gacaacatgaaatggtgtggaaccacccagaactatgacgcggaccagaagtttggattc
tgccccatggctgcccatgaggaaatctgtacaactaatgaaggggtgatgtatcgcgtt
ggagatcagtgggataagcaacacgacatgggccacatgatgaggtgcacatgtgttggc
aatggtcgtggggaatggacctgtgttgcctactcccagctccgagatcaatgcattgtc
gacgacatcacttataacgtgaatgacacatttcataagcgtcacgaagaggggcacatg
ctgaattgtacctgcttcggtcagggccggggcagatggaagtgtgatcccattgaccaa
tgccaggactcggaaacccgaacgttttatcagattggagactcctgggagaaatatgtg
catggtgtcaggtaccagtgctactgctatggccgtggcattggggagtggcattgccaa
cctttgcagacctacccaggcaccactggccctgtccaagtaatcatcacagagaccccc
agccagcccaactcacaccccatccagtggaacgcaccggagccatctcacatctctaag
tacatcctcagatggaaacccaaaaatgctccaggccgttggaaggaagccaccattcca
ggccacttgaactcatacactatcaaaggcctgaggccaggtgtggtatatgagggacag
ctcatcagtgtccagcactacggccacaaagaggtgacacgctttgacttcaccaccacc
agcacaagcccaccagtgaccagcaacactgtgactggagagacaacaccgttttccccc
gttgtggccacttctgaatctgtgactgaaatcaccgccagcagcttcgtggtctcttgg
gtctcagcttcagacaccgtgtcaggattccgtgtggaatatgagctgagtgaggaggga
gatgaaccacagtacctcgatcttccaagcacggccacttctgtaaacatccctgacctg
cttcctggccgaaaatacatcgtaaatgtctatcagatttctgaagaaggagagcagagt
ctgatcctgtctacttcgcagacaacagcgcctgatgcccctcctgatcctactgtggac
caagttgatgacacctcgattgttgttcgctggagcagacctcaggcacccatcacagga
tacagaatcgtgtattcaccatcagtagaagggagtagcacagaactcacccttcctgaa
actgccaactccgtcaccctcagcgacttgcaacctggggttcagtataacatcaccatc
tatgctgtggaagagaatcaagaaagtactcctgttttcatccaacaggaaaccactggc
gtcccacgtgcagataaagttccgcctccccgggacctgcagtttgtggaggtgacagac
gtgaagatcaccatcatgtggacaccccctgagagcgcggtgaccggctaccgtgtggac
gtgctccccgtcaacctgcctggggagcacggccagaggctgcccatcagcaggaacacg
tttgcagaagtcacagggctgtcccctggggtcacctatcacttcaaaatcttcgccgtg
aaccacgggagggaaagcaagcctctgacaggagaacagacaaccaaattggatgctccc
actaacctccggtttatcaatgaaactgagtcgactgtcgtagtgacctggacaccccct
cgggcccggatagccgggtatcggctgaccgtgggcctgacccggggaggccagcccaag
cagtacaacgtggggccctctgcctctcagtacccactgaggagtctgcagcctgggtct
gagtacaccgtcaccctcgtggccgtcaaaggcaaccagcagagccccaaagccactgga
gtctttactactctgcagtctccaggctccattccaccttacaacacagaggtgactgag
accaccattgtgattacatggacgcctgctccaaggattggttttaagctgggtgtgcga
ccaagccagggaggggaagcaccgcgagaagtgacttcagactcaggaagcatcgttgtg
tctggcctgaccccaggcgtggaatatgtttacaccatctcagtcctgagagatgggcag
gagagagatgcgccaatcgtgaagaaagtggtgacaccattgtctcccccaacaaacttg
cacctggaggcaaaccccgacactggagtgcttacggtctcctgggagaggagcaccacc
ccagacattactggttatagaatcaccaccacgcctacaagtggccaacaaggctattct
ctggaagaagtggttcatgcagatcagagttcttgcacttttgaaaacctgagtcctggc
ctggagtacaatgtcagtgtttacactgtcaaagatgacaaggaaagtgtccctatctct
gataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataaccgat
tcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtatcgcatc
acagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctcagta
ggatactacacagttacagggctggagcctggcattgactatgacatcagcgttatcact
ctcattaatggcggagagagtgcccctactacgctgacacaacaaaccgctgtccctcct
cccactgacctgcgattcaccaatgttggtccagacactatgcgtgtcacttgggcccca
cctccatctattgaattgaccaacctcctggtgcgctactcacccgtgaaaaatgaggaa
gatgttgcggaattgtcaatttctccttcagacaatgcagtggtcttaacaaatctcctg
cctgggacagaatacttagtcagtgtctccagcgtttacgaacaacacgagagcacacct
cttagaggaagacagaagacaggtctcgattccccaactggcattgacttttctgatatc
accgccaactctttcacggtccattggattgctcctcgagccaccatcactggctacagg
attcgccatcatcctgagcacactggtggaagaccacgagaggatcgagtgcctccctct
cggaattctatcaccctcaccaacctcaatccaggcacagaatatgtggtcagcatcgtt
gctcttaatggcagagaggaaagtcctcccttggttggccaacaatcaacagtttctgac
gttccaagggacctggaagttattgccacaacccccaccagcatcttgatcagctgggac
gctcctgccgtcacagtgagatattacaggatcacctatggagaaacaggaggaaatagc
cctgtccaggagttcactgtgcctggcagcaagtctacagctaccatcagtggccttaaa
cctggagtagactacaccatcaccgtttatgctgtcactggccgcggggacagcccagcc
agcagcaagccaatttccattgattaccgaacagaaattgacaaaccatcccagatgcaa
gtgactgatgttcaggacaacagcattagtgtcaggtggctgccttcaagttcccctgtt
actggctacagagtgaccactactcccaaaaatggcccaggacaatcaaaaactaaaact
gcaggtccagatcaaacagaaatgaccatcgaaggcttacaacccacagtggagtatgtg
gttagtgtctatgctcagaatcaaaacggagagagtcagcctctggttcagacagcagta
accaacattgatcgccctagaggactggcattcacagatgtggatgtcgattccatcaaa
attgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccct
gaggatggaatccatgagctattccctgcacctgatggtgaagaagacactgcagagctg
caaggcctcaggccgggttctgagtacacagtcagtgtggttgccttgcacgatgatatg
gagagccagcccctgattggaacccagtccacagccattcctgcaccaactgaactcaag
ttcactcaggttacaccaacaagcctgaccgcccagtggacagcacccaatgttcagctc
actgggtaccgcgtgcgggtgacccccaaggaaaagactggaccaatgaaagaaattaac
cttgctcccgatagcacatctgtggtcgtatcaggactcatggtggccaccaagtatgaa
gtgagtgtctatgctcttaaggacactttgacaagcagaccggctcagggaattgtcacg
accctggagaatgtcagccctccaagaagggcccgcgtgacagatgctactgagaccacc
atcaccattagctggagaaccaagactgagaccatcactggcttccaggttgatgccgtc
ccagcaaatggccagcctccaatccagagaaccatcaagccagatgtcagaagctacacc
atcacaggtttgcaacccggcactgactacaagatctatttgtacaccctgaatgacaat
gcccggagctcccctgtgatcatcgacgcctctactgccattgatgcaccatccaacctg
catttcctggccaccacgcccaactccttgctgatatcatggcagccaccccgtgccagg
attactggttacatcatcaagtatgagaagcctgggtcccctcccagagaagtggtccct
cggccccaccctggtgtcacagaggctactattactggtctggaaccaggaaccgagtac
actattcaagtcattgccatcaagaacaaccagaagagcgagcctctgatcgggaggaga
aagacagatgagcttccccaactggtaacccttccacaccccaatcttcacggaccagag
atcttggatgttccctccacagttcaaaagacccctttcatcaccaaccctgggtatgac
aatggaaacggtattcagcttcctggcacttctggtcagcagcccagtgttgggcaacaa
atgatctttgaggagcatggttttaggcgaaccacaccgcccacaacggccacccccgta
aggcataggccaagaccatatccgccgaatgtaaatgaggagatccaaattggtcatgtc
cccaggggagacgtagaccagcacctctaccctcacgttctgggactcaatccaaatacc
tctacaggacaagaggctctctctcagacaaccatctcttggaccccattccaggaaagc
tctgagtatatcatttcatgtcatccagttggcattgatgaagaacccttacagttccga
gttcctggaacctctgctagtgccaccctgacgggtcttaccagaggggccacctacaac
atcatagtggaggcactgaaagaccagaagaggcacaaggttcgggaggaggtcgttact
gtgggcaactctgttgaccaaggcctaggccaacctacggctgactcgtgcttcgacccc
tacaccgtctcccattacgccatcggagaggagtgggagcgactgtctgaatctggcttt
aaactctcctgccagtgcttagggtttggcagtggccatttcagatgcgattcgtctaaa
tggtgccatgacaatggtgtgaactacaagattggagagaagtgggatcgtcagggagaa
aatggccagatgatgagctgcacatgtcttggaaatggaaaaggagaattcaagtgtgac
cctcatgaagcaacatgttatgatgacgggaagacgtaccacgtaggagaacagtggcag
aaggagtatcttggtgctatttgctcctgcacatgctttggaggccagcggggctggcgc
tgtgacaactgccgcagacccggggctgaacccggtcacgaaggctccactgggcactcc
tacaaccagtattcacagagataccagcagagaaccaacaccaatgtcaactgcccaatt
gagtgcttcatgcctttagatgtacaggctgacagagatgattcccgagaataa

DBGET integrated database retrieval system