KEGG   Equus asinus (ass): 106833182Help
Entry
106833182         CDS       T04645                                 

Gene name
SCP2
Definition
(RefSeq) sterol carrier protein 2
  KO
K08764  sterol carrier protein 2 [EC:2.3.1.176]
Organism
eai  Equus asinus (ass)
Pathway
eai00120  Primary bile acid biosynthesis
eai01040  Biosynthesis of unsaturated fatty acids
eai01100  Metabolic pathways
eai01212  Fatty acid metabolism
eai03320  PPAR signaling pathway
eai04146  Peroxisome
Module
eai_M00861  beta-Oxidation, peroxisome, VLCFA
eai_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    106833182 (SCP2)
   01040 Biosynthesis of unsaturated fatty acids
    106833182 (SCP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106833182 (SCP2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106833182 (SCP2)
Enzymes [BR:eai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.176  propanoyl-CoA C-acyltransferase
     106833182 (SCP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCP2 Thiolase_N Thiolase_C Alkyl_sulf_C ketoacyl-synt SCP2_2 ACP_syn_III Ketoacyl-synt_C SpoVAD
Motif
Other DBs
NCBI-GeneID: 106833182
NCBI-ProteinID: XP_014699799
LinkDB All DBs
Position
Un
AA seq 547 aa AA seqDB search
MSPAASQCRPLRRVFVVGVGMTKFMKPGDENSRDYPDLAEEAGRKALADAQIPYSAVEQA
CVGYVFGDSTCGQRAIYHSLGLTGIPIVNVNNNCSTGSTALFLARQLIQGGMADCVLALG
FEKMEKGSLGTKFADRTNPIDKHLEVLANKYGLSAQPVTPQMFGCAGKEHMEKYGTKVEH
FAKIGWKNHKHSVNNPYSQFQEEYSLDDVMTSRKVFDFLTILQCCPSSNGAAAAVLASEA
FVQKYGLQSKAVEILAQEMVTDLPSSFEEKSIIKTVGFDMSKEAARKCYEKSGLRPSDID
VIELHDCFSTNELITYEALGLCPEGQGGKLVDRGDNTYGGKWVINPSGGLISKGHPLGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAAVVTLYRMGFPEAASYFGTHQIE
AAPTSSAVDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKN
GKGSVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQL
QPGKAKL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgccgcctcacagtgccggcctctgcgccgcgtgttcgtggtgggggtgggg
atgaccaagttcatgaagcctggagatgagaattcaagagactatcctgacttggcagaa
gaagcaggccggaaggctttagctgatgcacagatcccttattcagcagtggaacaggca
tgtgttggctacgtttttggtgactctacctgtgggcagagggctatctatcacagtttg
ggactgactggaattcctatagtcaatgtcaacaacaactgttctactggttctactgct
ttgtttctggcccggcagctgattcagggtggtatggcagattgtgtcttggctcttggg
tttgagaagatggagaagggatcccttggaacaaaatttgcagataggaccaatccaatc
gataaacatcttgaggtcctggccaataagtatggattgtctgcacaaccagttactcct
cagatgtttgggtgtgctggaaaagagcacatggaaaaatatggaacaaaagttgaacac
tttgcaaaaattggatggaaaaatcataagcattcagttaataacccgtattcccagttc
caagaggaatacagtttagacgatgtgatgacatctcgaaaagtttttgattttttgacg
atcttacagtgttgtccctcttccaacggtgctgcagcggcagttttggctagtgaagcg
tttgtgcagaagtacggcctgcaatccaaagctgtggaaattctggcgcaagagatggtg
actgatttgccaagctcatttgaagaaaaaagcattattaaaacggttggctttgatatg
agtaaagaagctgccagaaagtgctatgagaaatctggcctgagaccaagtgatattgat
gtaatagaacttcacgattgcttttctaccaatgaactcattacttatgaagcactggga
ctctgtccagaaggacaaggtggaaaactggttgatagaggcgataatacttatggagga
aagtgggtcataaatcctagcggtgggttgatttccaagggacacccactaggagctaca
ggtctggctcagtgcgctgaactctgctggcagctgagaggggaagccggaaaaaggcaa
gttcctggtgcaaaggttgctctgcagcataatttaggcattggaggagctgcagttgtc
acgctctacaggatgggttttcctgaagctgccagttattttggaactcatcaaattgag
gctgcaccaaccagctctgcagtcgatggatttaaggccaatcttgtctttaaggagatt
gagaagaagcttgaagaggaaggggaacaatttgtgaagaaaatcggtggtatttttgcc
ttcaaggtgaaggatggccccgggggtaaagaagccacctgggtggtggatgtgaagaac
ggcaaaggatcagtgcttcctaactcagataagaaggccgactgcacaatcacaatggcc
gactcggacttactggctttaatgacgggtaaaatgaatcctcagtcggccttctttcaa
ggcaaattgaaaatcactggcaacatgggtctggctatgaagttacaaaatcttcagctt
cagccaggcaaagctaagctgtga

DBGET integrated database retrieval system