KEGG   Equus asinus (ass): 106833295Help
Entry
106833295         CDS       T04645                                 

Gene name
PARP2
Definition
(RefSeq) poly(ADP-ribose) polymerase 2
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
eai  Equus asinus (ass)
Pathway
eai03410  Base excision repair
eai04210  Apoptosis
eai04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    106833295 (PARP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106833295 (PARP2)
   04217 Necroptosis
    106833295 (PARP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eai03032]
    106833295 (PARP2)
   03036 Chromosome and associated proteins [BR:eai03036]
    106833295 (PARP2)
   03400 DNA repair and recombination proteins [BR:eai03400]
    106833295 (PARP2)
Enzymes [BR:eai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     106833295 (PARP2)
DNA replication proteins [BR:eai03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     106833295 (PARP2)
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    106833295 (PARP2)
DNA repair and recombination proteins [BR:eai03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     106833295 (PARP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 106833295
NCBI-ProteinID: XP_014699989
LinkDB All DBs
Position
Un
AA seq 573 aa AA seqDB search
MAARRRLRGRNSSRPGASVALNETERVNNGHTATKDPPPAKKSRRCPRQGVKKEPVAGGK
TDKEKAEDKQESVRTLLFKGKVPVDPECTAKVGKAHVYCERNDVYDAMLNQTNLQFNNNK
YYVIQLLEDDAQRNFSVWMRWGRVGKVGQHSLVACSGDLNKAKEIFQKKFLDKTKNNWEG
REKFEKVPGKYDMLQMDYSTTIQSEEETKKEESLKSPLKPESQLDLRVQELIKLICNVQA
MEEMMVEMKYDTKKAPLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALTEACNEFYTRIP
HDFGLRTPPLIRTEKELSEKVQLLEALGDIEIAMKLVKTELQSPEHPLDQHYRKLHCALR
PLDRDSCEFKVISQYLQSTHAPTHSDYTMTLLDVFEVEKEGEKETFREDLHNRMLLWHGS
RLSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASHLQDTGLLLLSEV
ALGQCNELLEANPEAEGLLQGKHSTKGLGKMAPSPACFTTLNGSTVPLGPASETGILNPE
GYTLNYNEFIVYSPNQVRMRYLLKIRFNFLQLW
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcggcggcggttgcgggggaggaacagcagtcgacctggagcttctgtagca
ttaaatgaaaccgaaagagttaataatggccacacagctacaaaagaccctccccctgcc
aagaaatctcgaagatgcccgaggcagggggtgaaaaaggagcctgtggctggaggaaag
actgataaggaaaaggcagaagacaagcaagagtctgtgaggaccttgctgtttaaaggc
aaagttccagtggacccagagtgcacagccaaggtggggaaggcccatgtgtactgtgaa
aggaatgatgtctatgatgccatgctgaatcagaccaatcttcagttcaacaacaacaag
tactatgtgattcaactgttagaagatgatgcccagaggaacttcagtgtttggatgaga
tggggccgagttgggaaagtggggcagcacagcttggtggcttgttcaggggacctcaac
aaggccaaggaaatctttcagaagaaattccttgacaaaacaaaaaacaattgggagggt
cgtgagaagtttgagaaggtgcctggcaaatatgatatgctgcagatggactattccacc
actattcagagtgaagaggaaactaaaaaagaggaatctcttaaatcccccttgaaacca
gagtcacagctagatcttcgtgtccaggagctgataaagttgatctgtaatgtccaggcc
atggaagagatgatggtagaaatgaaatatgataccaagaaagccccacttggaaagctg
acagtggcacaaatcaaggcaggttaccagtcgcttaagaagattgaggattgtattcga
gctggccagcatggacgagctctcacagaagcatgcaatgaattctatactaggatccca
catgactttggactccgtacccctcctttaatccggacagagaaagaactgtcagaaaaa
gtacagctgctagaggctttgggagatattgaaattgccatgaagctggtgaagacagag
ctgcaaagcccagaacacccattggaccaacactatagaaaattacattgtgccttgcgc
cctctagaccgtgacagttgtgagttcaaagtgatttcccagtacctacagtctactcat
gctcccacacacagtgactataccatgaccttgctggatgtttttgaagtagagaaggag
ggtgagaaagaaaccttcagagaggaccttcataacaggatgctgctatggcatggttcc
aggctgagtaattgggtgggaatcctgagccatgggcttcgaattgccccacctgaagct
cccatcacaggttacatgtttggaaaaggaatctactttgctgacatgtcttccaagagt
gccaattactgctttgcctctcacctacaggatactggactgctgctcttatcagaggtc
gctctaggtcagtgtaatgagctactagaggccaatcctgaggccgaagggttacttcaa
ggaaaacacagcaccaaaggattgggcaagatggctcccagtcctgcctgcttcaccacc
ctgaatggaagtacagtgcccttaggaccagcaagtgaaacaggaattctgaatccagag
ggttataccctcaattacaatgaatttattgtctacagccccaaccaggtccgtatgcga
taccttctaaagattcgatttaatttcttgcagttgtggtga

DBGET integrated database retrieval system