KEGG   Equus asinus (ass): 106833569
Entry
106833569         CDS       T04645                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
eai  Equus asinus (ass)
Pathway
eai01523  Antifolate resistance
eai04010  MAPK signaling pathway
eai04014  Ras signaling pathway
eai04024  cAMP signaling pathway
eai04062  Chemokine signaling pathway
eai04064  NF-kappa B signaling pathway
eai04066  HIF-1 signaling pathway
eai04071  Sphingolipid signaling pathway
eai04137  Mitophagy - animal
eai04151  PI3K-Akt signaling pathway
eai04210  Apoptosis
eai04211  Longevity regulating pathway
eai04218  Cellular senescence
eai04380  Osteoclast differentiation
eai04620  Toll-like receptor signaling pathway
eai04621  NOD-like receptor signaling pathway
eai04622  RIG-I-like receptor signaling pathway
eai04623  Cytosolic DNA-sensing pathway
eai04625  C-type lectin receptor signaling pathway
eai04657  IL-17 signaling pathway
eai04658  Th1 and Th2 cell differentiation
eai04659  Th17 cell differentiation
eai04660  T cell receptor signaling pathway
eai04662  B cell receptor signaling pathway
eai04668  TNF signaling pathway
eai04722  Neurotrophin signaling pathway
eai04917  Prolactin signaling pathway
eai04920  Adipocytokine signaling pathway
eai04926  Relaxin signaling pathway
eai04931  Insulin resistance
eai04932  Non-alcoholic fatty liver disease
eai04933  AGE-RAGE signaling pathway in diabetic complications
eai05010  Alzheimer disease
eai05022  Pathways of neurodegeneration - multiple diseases
eai05030  Cocaine addiction
eai05132  Salmonella infection
eai05133  Pertussis
eai05134  Legionellosis
eai05135  Yersinia infection
eai05140  Leishmaniasis
eai05142  Chagas disease
eai05145  Toxoplasmosis
eai05146  Amoebiasis
eai05152  Tuberculosis
eai05160  Hepatitis C
eai05161  Hepatitis B
eai05162  Measles
eai05163  Human cytomegalovirus infection
eai05164  Influenza A
eai05165  Human papillomavirus infection
eai05166  Human T-cell leukemia virus 1 infection
eai05167  Kaposi sarcoma-associated herpesvirus infection
eai05168  Herpes simplex virus 1 infection
eai05169  Epstein-Barr virus infection
eai05170  Human immunodeficiency virus 1 infection
eai05200  Pathways in cancer
eai05202  Transcriptional misregulation in cancer
eai05203  Viral carcinogenesis
eai05212  Pancreatic cancer
eai05215  Prostate cancer
eai05220  Chronic myeloid leukemia
eai05221  Acute myeloid leukemia
eai05222  Small cell lung cancer
eai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
eai05321  Inflammatory bowel disease
eai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106833569 (RELA)
   04014 Ras signaling pathway
    106833569 (RELA)
   04064 NF-kappa B signaling pathway
    106833569 (RELA)
   04668 TNF signaling pathway
    106833569 (RELA)
   04066 HIF-1 signaling pathway
    106833569 (RELA)
   04071 Sphingolipid signaling pathway
    106833569 (RELA)
   04024 cAMP signaling pathway
    106833569 (RELA)
   04151 PI3K-Akt signaling pathway
    106833569 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106833569 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    106833569 (RELA)
   04218 Cellular senescence
    106833569 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106833569 (RELA)
   04621 NOD-like receptor signaling pathway
    106833569 (RELA)
   04622 RIG-I-like receptor signaling pathway
    106833569 (RELA)
   04623 Cytosolic DNA-sensing pathway
    106833569 (RELA)
   04625 C-type lectin receptor signaling pathway
    106833569 (RELA)
   04660 T cell receptor signaling pathway
    106833569 (RELA)
   04658 Th1 and Th2 cell differentiation
    106833569 (RELA)
   04659 Th17 cell differentiation
    106833569 (RELA)
   04657 IL-17 signaling pathway
    106833569 (RELA)
   04662 B cell receptor signaling pathway
    106833569 (RELA)
   04062 Chemokine signaling pathway
    106833569 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106833569 (RELA)
   04917 Prolactin signaling pathway
    106833569 (RELA)
   04926 Relaxin signaling pathway
    106833569 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    106833569 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106833569 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    106833569 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106833569 (RELA)
   05202 Transcriptional misregulation in cancer
    106833569 (RELA)
   05203 Viral carcinogenesis
    106833569 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106833569 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    106833569 (RELA)
   05221 Acute myeloid leukemia
    106833569 (RELA)
   05220 Chronic myeloid leukemia
    106833569 (RELA)
   05215 Prostate cancer
    106833569 (RELA)
   05222 Small cell lung cancer
    106833569 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    106833569 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106833569 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    106833569 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    106833569 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106833569 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106833569 (RELA)
   04931 Insulin resistance
    106833569 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    106833569 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106833569 (RELA)
   05135 Yersinia infection
    106833569 (RELA)
   05133 Pertussis
    106833569 (RELA)
   05134 Legionellosis
    106833569 (RELA)
   05152 Tuberculosis
    106833569 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106833569 (RELA)
   05170 Human immunodeficiency virus 1 infection
    106833569 (RELA)
   05162 Measles
    106833569 (RELA)
   05164 Influenza A
    106833569 (RELA)
   05161 Hepatitis B
    106833569 (RELA)
   05160 Hepatitis C
    106833569 (RELA)
   05168 Herpes simplex virus 1 infection
    106833569 (RELA)
   05163 Human cytomegalovirus infection
    106833569 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106833569 (RELA)
   05169 Epstein-Barr virus infection
    106833569 (RELA)
   05165 Human papillomavirus infection
    106833569 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106833569 (RELA)
   05145 Toxoplasmosis
    106833569 (RELA)
   05140 Leishmaniasis
    106833569 (RELA)
   05142 Chagas disease
    106833569 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    106833569 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eai03000]
    106833569 (RELA)
Transcription factors [BR:eai03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    106833569 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 106833569
NCBI-ProteinID: XP_014700317
LinkDB
Position
Un
AA seq 551 aa
MEDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPARSSASVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGTIPSQTSALAPAPAPVLAQAPAPAPAMASALAQAPAPVPVLAAGLAQAV
APPAPRTTQAGEGTLTEALLQLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ
GVSMAPHTAEPMLMEYPEAITRLMSGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSISDM
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggaagacctgttccccctcatcttcccttcggagccagcccaggcttctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctcagcgggcagcatcccgggcgagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacacggggccagggacagttcgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtggggaaagactgccgggacggcttctat
gaggctgagctctgccctgaccgctgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgagacctggagcaggccatcagtcagcgcatccagaccaacaacaacccc
ttccaagttcccatagaagagcagcgtggggactacgacctgaatgcggtgcggctatgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcctgtcgcctgtcctttct
catcccatctttgacaaccgcgcccccaacactgctgagctcaagatctgccgagtgaac
cggaactccgggagctgcctcgggggcgatgagatcttcctgctttgtgacaaggtgcag
aaagaggacatcgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttca
caagccgatgttcaccgacaagtggccattgtgttccggacacctccctatgcggacccc
agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcggatcgggagctc
agcgagcccatggagttccagtatttgccagacacagatgatcgtcaccgaattgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga
cccaccgacccccggcccccgccccggcgcattgctgtgcctgcccgcagctcagcctcc
gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttt
gaggaattttcccccatggtctttccttctgggacgatcccaagccagacctcggccttg
gcaccagcccctgccccagtcctggcgcaggccccagcccctgccccagccatggcatca
gctctggcccaggccccagctcccgttcctgtcctagccgcaggccttgctcaggccgtg
gccccgcctgcccccaggaccacccaagctggggaagggacactgacggaggccctgctg
cagctgcagtttgatgctgatgaagacctgggggccctgctcggcaataacactgacccg
gccgtgttcacggacctggcatctgtcgacaactctgagtttcagcagctgctgaaccag
ggtgtctctatggccccccacacagctgagcccatgctgatggagtaccctgaggctata
actcgcctgatgtcagggtcccagcggccccctgacccagctcccgctcccctgggggcc
tccgggctccccaacggtctcctctcaggggacgaagacttctcctccatttcggacatg
gacttctcagcccttctgagtcagatcagctcctag

DBGET integrated database retrieval system