KEGG   Equus asinus (ass): 106833836Help
Entry
106833836         CDS       T04645                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
eai  Equus asinus (ass)
Pathway
eai04080  Neuroactive ligand-receptor interaction
eai04972  Pancreatic secretion
eai04974  Protein digestion and absorption
eai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106833836
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    106833836
   04974 Protein digestion and absorption
    106833836
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    106833836
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eai01002]
    106833836
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eai04147]
    106833836
Enzymes [BR:eai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     106833836
Peptidases [BR:eai01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106833836
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106833836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 106833836
NCBI-ProteinID: XP_014700691
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MNPLLVLAFVGAAVAFPVDDDDKIVGGYTCEENSIPYQVSLNSGYHFCGGSLIDAQWVVS
AAHCYKSRIQVRLGEYNIEVVEGNEQFINAAKIIRHPKYNSWTLDNDILLIKLASPAVIN
ARVSSISLPSASAPAGTLCLISGWGNTLSSGSNYPDLLQCLEAPLLSQAECEASYPGEIT
KNMVCAGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNRPGVYTKVSNYVDWIQ
QTIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacttctggttcttgcctttgtgggagctgctgttgctttccccgttgacgat
gatgacaagatcgtcgggggctacacctgtgaggagaattccatcccctaccaggtgtcc
ctgaactctggctaccacttctgtggtggctccctcattgatgcccagtgggtggtgtcc
gctgctcactgctacaaatcccgcatccaggtgagactaggagagtacaacatcgaagtc
gtggaagggaacgagcagttcatcaacgcggccaagatcatccgccaccccaagtacaac
agctggaccctggacaatgacatcttgctgattaagctcgcctcgcctgcagtcatcaat
gcccgggtgtcctccatctccctgcccagcgccagtgctcctgctggcaccctgtgcctc
atctctggctggggcaacaccctgagctctggcagcaactacccagacctgctgcagtgc
ctggaagccccgctgctgagtcaggctgagtgcgaggcctcctaccccggggagatcacc
aagaacatggtctgcgccggcttcctggagggaggcaaggactcctgccagggtgactct
gggggccctgtggtctgcaatggacagctccagggcattgtctcctggggctatggctgc
gcccagaagaacaggcctggagtctacaccaaggtgtccaactacgtggactggattcag
cagaccatcgctgccaacagctaa

DBGET integrated database retrieval system