KEGG   Equus asinus (ass): 106833978
Entry
106833978         CDS       T04645                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
eai  Equus asinus (ass)
Pathway
eai04010  MAPK signaling pathway
eai04020  Calcium signaling pathway
eai04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106833978 (CACNA1E)
   04020 Calcium signaling pathway
    106833978 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    106833978 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:eai04040]
    106833978 (CACNA1E)
Ion channels [BR:eai04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106833978 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 106833978
NCBI-ProteinID: XP_014700862
LinkDB
Position
Un
AA seq 2250 aa
MNHREGCVPLSLVNLFLNSSFLTPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEK
TEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDL
RTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGK
LHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVLTVFQCI
TMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRA
FMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRTEAMTRD
SSDEHCVDISSVGTPLARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYWIVLSLV
ALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFG
VTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISL
LFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNG
IRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQK
HALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLR
RHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRSRPIEGLALGLGLEKCE
EERISRGGSLKGDGGDLSSALDNQRSPLSLGKREPPWLSRPCHGNCDPTQQEAGGGETVV
TFEDRARHRQSQRRSRHRRVRTEGKEPTSTSRSRSASQERSLDEGVSTEGEKDCEPRGSH
GVKEPTIQEEERARDLRRTNSLMVSRGSGLAGALDEANTPLVLPQPELEVGKDAALTEQE
PEGSSEQALLGDVHLDMGRAISQSEPDLSCSTANTDKAATESTSVTVAIPDVGPLVDSTV
VHISNKTDGEASPLKEAEIKEEEEEEVEKKQQKKEKRETGKAMVPHSSMFIFSTTNPIRR
ACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIK
MIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLR
PLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKD
TEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDV
TEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNER
ACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTIVLMMKYYSAPC
TYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKL
VNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAII
GMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTA
PSGQTENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEF
VRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVH
FTSTLMALIRTALDIKIAKGGADRQQLDAELQKETLAIWPHLSQKMLDLLVPMPKASDLT
VGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQD
PVSGLSGHSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSEFKSVQPSNHGIY
LPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSE
NTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEE
RGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQLPPVPP
KPRPLLSYSSLIRQHTGSISPPADGSEGGSPLASQALESNDAILTESSNSRHAQQGPHSS
PQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHY
RRRRRGGPGPGVMCGAVSDLLSDTEEDDKC
NT seq 6753 nt   +upstreamnt  +downstreamnt
atgaaccaccgggaaggctgtgtccctctctctttggtgaatctgttccttaactcctct
tttctcacgccatttgagtacatgatcctggccaccatcattgccaactgcatcgtcttg
gccctggagcagcaccttcctgaggatgacaagaccccaatgtcccgcagactggagaag
acagaaccatatttcattgggatcttttgctttgaagctggcatcaaaatcgtggccctg
gggttcatcttccataagggctcgtacctccgcaatggctggaatgtcatggacttcatt
gtggtcctcagtggcatcctggccaccgcgggaacccacttcaatacacacgtggacctg
aggaccctccgggccgtgcgtgtcctgaggcccctgaagctcgtgtcaggcattcctagc
ctgcagattgtgttgaagtccatcatgaaggccatggtgcctcttctgcagattggcctt
ctgctcttctttgccatcctgatgtttgctatcattggcttggagttctacagtgggaag
ttgcaccgagcatgcttcatgaacaattcaggtattctagaaggatttgacccccctcac
ccatgtggcgtgcagggctgcccagctggttatgaatgcagggactggattggccccaac
gatgggatcacccagtttgataacatcctttttgctgtgctgactgtcttccagtgcatc
accatggaagggtggaccaccgtgctgtacaataccaatgatgccttaggagccacctgg
aattggctgtacttcatccccctcatcatcattggatccttctttgttctcaacctagtc
ctgggagtgctttccggggaatttgccaaagagagagagagagtggagaaccggagagct
ttcatgaaactgcggcgccagcagcagattgagcgcgagctgaacgggtaccgcgcctgg
atagacaaagcagaggaagtcatgcttgctgaagaaaataaaaatgctgggacgtcagcc
ttagaagtgcttcgaagggcaacaatcaaaaggagcagaacggaggctatgactcgagac
tccagcgacgagcactgtgtcgatatctcctctgtgggcacacctcttgcccgagccagc
atcaagagtgccaaagtggacggggcctcctatttccggcacaaggaaaggcttctgcgc
atttctatccgccacatggttaaatcccaggtgttttactggattgtgctgagccttgtg
gctcttaacactgcctgtgtggccatcgtccatcataaccagccccagtggctcacccac
ctcctctactatgcagaatttttgtttctggggctcttcctcttggagatgtccctgaag
atgtacggcatggggccccgcctttattttcactcttcattcaactgctttgattttggg
gtcacagtgggcagtatcttcgaagtggtctgggcaatcttcagacctggtacatctttt
ggaatcagtgtcttacgagctctccggcttctaagaatatttaaaataaccaagtactgg
gcatccctacggaatttggtggtctccttgatgagttccatgaagtcgatcatcagtttg
ctcttcctcctcttcctcttcatcgttgtctttgctcttctaggaatgcagctgtttgga
ggcaggtttaattttaatgatgggactccttcagcaaactttgacaccttcccagcagcc
atcatgactgtattccagatcctgacgggtgaggactggaatgaggtgatgtacaatggg
atccgctcccaggggggggtcagctcaggcatgtggtcggctatctacttcattgtgctc
accttgtttggaaactacacgctgctgaatgtgttcttggccattgctgtggacaatctg
gccaatgcccaggagctgaccaaggatgagcaggaagaagaggaagccttcaaccagaaa
cacgcactgcagaaggccaaggaggtcagcccgatgtccgcacccaacatgccatctatc
gaaagagacagaaggagaagacaccacatgtcgatgtgggagccacgcagcagccacctg
agggagcggaggcgccgacaccacatgtcggtgtgggagcagcgcaccagccagctgaga
aggcacatgcagatgtccagccaggaggctctcaataaagaggaggccccgccaatgaac
cccctcaaccctctcaacccactgagccccctcaacccactcaacgcccaccccagcctc
taccggagatcaaggcccattgagggcctggccctgggcctgggcctggagaagtgcgag
gaggaacgcatcagccgtggcggatccctcaagggggacggaggggatctctcgagtgcc
ctggacaatcagaggagccccttgtctctgggcaaacgggagccgccgtggctgtccagg
ccctgtcatgggaactgtgacccgacccagcaggaggctgggggaggggagaccgtggtg
accttcgaggaccgggccaggcaccggcagagccagcggcgcagccggcaccgccgcgtg
cggacagaaggcaaggagcccacctccacctcccggagcaggtctgccagccaggagcgg
agtctggatgaaggggtgtctaccgagggggagaaggactgtgagcccaggggcagccat
ggggtcaaggaacccacaatccaggaagaagagcgagcccgggatttaaggaggactaac
agtctgatggtgtccagaggctctgggctggcaggagccctcgatgaggccaacacaccc
ctagtcctgccccaacccgagctggaagtggggaaggatgcagcgctgacagagcaggag
ccggagggcagcagtgagcaagccctgctgggggacgtgcatctggacatgggccgggcc
atcagccagagtgagcctgacctctcctgctccacagccaacacagataaggccgccact
gagagcaccagcgtcactgttgccatccctgacgtgggccccttggtggactctacagtg
gtgcacattagcaacaagacggatggagaagccagtcccctgaaggaggcggagatcaaa
gaggaggaggaggaggaggtggagaagaagcagcagaagaaggagaagcgtgagacgggc
aaagccatggtgccccacagctctatgttcatcttcagcaccaccaacccgattcgcagg
gcctgccactacatcgtgaacctgcgctactttgagatgtgcattctcctggtcatcgca
gccagcagcattgccctggcagccgaggaccctgtcctgaccaactcggagcgcaacaaa
gtcctgaggtattttgactatgttttcactggcgtgttcaccttcgagatggttataaag
atgatagaccagggcttgatcctgcaggatgggtcctacttccgagacctgtggaacatc
ctggactttgtggtggtagttggcgcattggtggcctttgctttggcgaacgctttggga
accaacaaggggcgggacatcaagaccatcaagtctttgcgggtgctccgagttctgagg
ccactgaagaccatcaagcgcttgcccaagcttaaggctgtgttcgactgtgtggtgacc
tccttgaaaaacgtcttcaacatcctcatcgtctacaagctcttcatgttcatctttgct
gtcatcgcagttcagcttttcaagggaaagttcttttattgcacggacagttccaaggac
accgagaaagagtgcataggcaactatgtagatcatgagaaaaacaagatggaggtcaaa
ggccgagaatggaagcgccatgagttccactatgacaacattatctgggccctgctgacc
ctcttcactgtctccacgggggaaggatggcctcaagttttgcaacattctgttgatgtg
acagaggaagaccgaggcccaagccgcagcaaccgcatggagatgtccatcttttacgtg
gtctattttgtagtcttccctttcttctttgtcaatatctttgtggctctcattatcatc
accttccaggagcaaggtgacaagatgatggaggagtgcagcctggagaagaatgagagg
gcgtgtatcgacttcgccatcagtgccaaaccccttacccgctacatgccgcagaacagg
cacaccttccagtaccgtgtctggcactttgtggtatccccatcctttgagtacaccatc
atggccatgatcgccttgaacaccatcgtgctgatgatgaagtactactctgctccctgt
acctatgaactggccctgaagtacctgaacatcgccttcaccatggtgttttccctggaa
tgtgtcctaaagatcattgcatttggcttcttgaactatttccgagacacctggaatatc
tttgacttcatcaccgtgatcggaagcatcacagaaattattctgacagacagcaagctg
gtgaacaccagtggcttcaatatgagctttctgaagctcttccgagccgcccgcctcatc
aagcttctgcgtcagggctacaccatccgtattttactttggaccttcgtccagtccttt
aaggccctgccctacgtctgccttttgattgccatgcttttcttcatctacgccatcatt
gggatgcaggtatttggaaacataaaattagatgaggagagtcacatcaaccggcacaac
aacttccggagtttctttgggtcgctcatgttactcttcaggagtgccacaggtgaggcc
tggcaggagatcatgctgtcgtgcctcggggagaaaggctgtgagccggacaccaccgca
ccctcagggcagaccgagaatgagcgttgcggcactgatcttgcctacgtttactttgtc
tctttcatcttcttctgctccttcttgatgctcaacctgtttgtggctgtcatcatggac
aactttgagtacctgactcgggattcgtctatcctagggcctcaccacttggacgagttt
gtccgtgtctgggcagaatatgacagagctgcatgtggccgcatccattacactgagatg
tatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgtccctccaaa
gtggcatataagaggttggtcctgatgaacatgccagtggctgaagacatgacagtccac
ttcacctccacacttatggctctgatccggacagctctggatatcaaaattgccaaaggt
ggtgcagacaggcagcagctagacgcagagctacaaaaggaaaccctggccatttggcct
cacctgtcccagaagatgctggatctgctggtgcccatgcccaaagcctctgacctgact
gtgggcaaaatctatgcagcaatgatgatcatggactactataaacagagtaaggtgaag
aagcaaaggcagcagctggaggaacagaaaaacgcacccatgttccagcgcatggagccc
tcatctctgcctcaggagatcatcgctaatgccaaagccctgccttatctccagcaggac
cccgtctcaggcctgagtggccatagtggatacccttcgatgagtccactctccccccag
gaaatattccagttggcttgtatggacccagcagatgacggacagttccaggaacagcag
tctctggagccagaggttagtgaatttaaaagcgtgcagccctctaaccatggcatctac
cttccttcggacacccaggagcatgcgggatctgggagggcatcctctatgccacgcctg
actgtggatccccaggtggtgacagaccccagctccatgagacgatcattttccactatt
cgggataagcgttccaattcctcatggttggaggaattctccatggaacgaagcagtgaa
aacacctacaagtcacgtcgccggagttaccactcctccctcaggctgtcagcccatcgc
ctgaactctgactcaggccacaagtccgacacccaccgctcagggggcagagagcgggga
cgatcgaaagagcgaaagcatcttctctctcctgatgtctcccgctgcaactcagaggag
cgagggacccaggccgactgggagtccccagagcgtcgtcagtccaggtctcccagtgag
ggcagatcacagacccccaacagacagggcacgggctccctgagtgaaagctccatcccc
tccgtctctgacaccagcaccccaagacggagtcgtcggcagctcccaccagtccctcct
aagcctcggcccctcctctcctacagctccctgatacgacaacacaccgggagcatctcg
ccacccgctgatgggagtgagggtggctccccactggcctcccaagctctggagagcaac
gacgctatcctgaccgagtcttccaactcccggcacgcacagcagggcccacactcctcc
ccacagcgctacatctccgagccctacctggccctgcacgaagactcccatgcctcggac
tgtggcgaggaggagacgcttacctttgaagcagctgtggctaccagcctgggccgttcc
aacaccatcggctcagccccgcccctgcggcacagctggcagatgcccaatgggcactat
cggcggcggaggcgtggggggccggggccaggcgtgatgtgtggagctgtcagcgacctc
ctgagcgacacagaagaagacgacaaatgctag

DBGET integrated database retrieval system