KEGG   Equus asinus (ass): 106834088
Entry
106834088         CDS       T04645                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
eai  Equus asinus (ass)
Pathway
eai04060  Cytokine-cytokine receptor interaction
eai04061  Viral protein interaction with cytokine and cytokine receptor
eai04151  PI3K-Akt signaling pathway
eai04625  C-type lectin receptor signaling pathway
eai04630  JAK-STAT signaling pathway
eai04658  Th1 and Th2 cell differentiation
eai04659  Th17 cell differentiation
eai04660  T cell receptor signaling pathway
eai04672  Intestinal immune network for IgA production
eai04940  Type I diabetes mellitus
eai05135  Yersinia infection
eai05142  Chagas disease
eai05162  Measles
eai05166  Human T-cell leukemia virus 1 infection
eai05200  Pathways in cancer
eai05320  Autoimmune thyroid disease
eai05321  Inflammatory bowel disease
eai05330  Allograft rejection
eai05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106834088 (IL2)
   04151 PI3K-Akt signaling pathway
    106834088 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106834088 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    106834088 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106834088 (IL2)
   04660 T cell receptor signaling pathway
    106834088 (IL2)
   04658 Th1 and Th2 cell differentiation
    106834088 (IL2)
   04659 Th17 cell differentiation
    106834088 (IL2)
   04672 Intestinal immune network for IgA production
    106834088 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106834088 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106834088 (IL2)
   05321 Inflammatory bowel disease
    106834088 (IL2)
   05330 Allograft rejection
    106834088 (IL2)
   05332 Graft-versus-host disease
    106834088 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    106834088 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    106834088 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106834088 (IL2)
   05162 Measles
    106834088 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    106834088 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:eai04052]
    106834088 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:eai00536]
    106834088 (IL2)
Cytokines and growth factors [BR:eai04052]
 Cytokines
  Interleukins
   106834088 (IL2)
Glycosaminoglycan binding proteins [BR:eai00536]
 Heparan sulfate / Haparin
  Cytokines
   106834088 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 106834088
NCBI-ProteinID: XP_014701010
LinkDB
Position
Un
AA seq 149 aa
MYKMQLLACIALTLAVLANSAPTSSSKRETQQQLKQLQMDLKLLLEGVNNNKNPKLSKML
TFKINMPKKATELKHLQCLEEELKPLEEMLKNFLSKDIKELMSNINVTVLGLKGSETRFT
CEYDDETGTIVEFLNKWITFCQSIFSTMT
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtacaagatgcaactcttggcttgcatcgcactaactcttgcagtccttgcaaacagt
gcacctacttcaagctctaagagggaaacacagcaacaactgaagcaattacagatggat
ttaaagttgcttttggaaggagttaataataacaagaatcccaaactctccaagatgctc
acatttaaaattaacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaaatgctaaaaaactttctctcgaaagatatcaaggaa
ttaatgagcaatatcaatgtaacagttctgggactaaaggggtctgaaacaagattcaca
tgtgaatatgatgatgagacaggaacaattgtagaatttctgaacaaatggattaccttt
tgtcaaagcatcttctcaacaatgacttga

DBGET integrated database retrieval system