KEGG   Equus asinus (ass): 106834209Help
Entry
106834209         CDS       T04645                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
eai  Equus asinus (ass)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eai01002]
    106834209 (TMPRSS9)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     106834209 (TMPRSS9)
Peptidases [BR:eai01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106834209 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a PRKCSH-like
Motif
Other DBs
NCBI-GeneID: 106834209
NCBI-ProteinID: XP_014701189
LinkDB All DBs
Position
Un
AA seq 936 aa AA seqDB search
MEPTVGDLQLTPGATKEVPAPDAACCRAALSAVVATSIIVVTLGALVASFSTQGIAVEHA
ARLGGLRYAASLQREGSAYHRALTAALRTLLHFVLQALETLSPGLEEELLQRGLRARLQG
RGLPLAAYGTIVSAQLIGNQRGPPTDRDLKSGRCPADAFACGNSQCVTKVNPECDDSVDC
PDGSDEARCDCGLQPGWRTAGRIVGGVAASPGEFPWQVSLRENGEHFCGAAVVGARWLVS
AAHCFNEXXXPTEWVAYAGPPSLSGSEASTVRARVARIVTHPAYDSDTADFDVAVLELGS
PLPFSRHVQPVCLPAATHIFPPRRKCLISGWGYLKEDFLVKPERLQKATVELLDQALCAG
LYGPSLTDRMLCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGV
YARVTSLSNWILEAIATPSKPPAPTVAPAPATSSTAWPSSAESRGVDTPTPPMLAPSPAP
RDPVTASKPQECGVRPALEKPSRIVGGLGAAPGEVPWQASLEEGSRHFCGAAVVGDRWLL
SAAHCFNHTKVELVRAHLGTASLAGVGGSPVKMGLKRAVLHPQYDPGLLDFDVAVLELAG
PLVFNKYVQPVCLPLAVQKFPVGRKCMISGWGNTQEGTASKPDILQRASVGIIDQKACSA
LYNFSLTDRMLCAGFLEGQVDSCQGDSGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGV
YSRITRLKGWILDTMSSQPLPAPPPATTRTPATTSQAPRTTAGLTAPGVTASRPTPLATS
GATSHPANRTATAMGTTTRGQMPLPQAPETTLGPQPPGVGAPRCRAGARLQRPVSPAGSM
ARQLQKAAVRPLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWV
LTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQNIQE
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaccgtgggtgacttacagctcacgcccggggccacaaaggaagtccctgct
ccagatgccgcatgctgccgagcggccctctctgctgtcgtggccaccagcatcatcgtc
gtcaccctgggagccctcgtggcctccttctccacgcagggcatcgccgtggagcacgcg
gcccggctggggggcctgcgctacgccgccagcctgcagcgggagggctcagcctaccac
cgcgcactgactgccgccctgcggacgctgctgcactttgtgctgcaagcgctggagacg
ctgagcccgggcctggaggaggagctgctgcagcggggtctccgcgcgaggctgcagggg
cgaggcctccccctggctgcctacggcaccatcgtgtccgcccagctcataggcaaccag
cgggggccaccgacggacagagacttgaaatcaggtcgctgcccggcggacgccttcgcc
tgcgggaacagccagtgtgtcactaaggtgaaccccgagtgtgacgacagcgtggactgc
cccgatggatccgacgaggcccgctgtgactgcggcttgcagcccggctggaggacggcg
ggcaggatcgtgggcggcgtggcggcgtccccgggggagttcccgtggcaagtcagcctc
cgagagaacggcgagcacttctgcggggcggccgtggtcggggcccggtggctggtgtcg
gccgcccactgcttcaacgagnnnnnnnnccccacggagtgggtggcctacgcgggcccc
ccctccctcagcggctcggaggccagcaccgtgcgggcccgcgtggcccggatcgtcaca
caccccgcctacgactcggacacggccgacttcgacgtggcggtgctggagctgggcagc
cccctccccttcagcaggcacgtccagcccgtgtgcctcccggcagccacgcacatcttc
ccgccccggaggaagtgtctcatctccggctggggctacctcaaggaggacttcctggtc
aagccggagaggctgcagaaggccaccgtggagctgctggaccaggccctgtgcgccggc
ctgtacggcccctcgctcaccgaccggatgctgtgcgccggctacctggacggcaaggtg
gactcctgccagggggactcggggggccccctggtctgcgaggagccgtccggcaggttc
ttcctggctggcatcgtgagctggggaatcgggtgcgcagaagcgcggcggccaggggtc
tacgcccgagtgaccagcctgagcaactggatcctggaggccatcgccaccccgagcaag
cccccagcccccactgtggcccctgcgcccgccacctccagcaccgcctggcccagcagc
gccgagagccggggggtggacactcccaccccacccatgctggcccccagccctgcacct
cgggacccagtcactgcgtctaagccgcaagagtgcggggtccggccggccctggagaag
cccagccgcatcgtgggcgggctgggagccgcccccggggaggtgccctggcaggccagc
ctggaggaggggtcccggcacttctgcggagcggccgtggtaggggaccgctggctactg
tcggccgcgcactgcttcaaccacaccaaggtggagctggtgcgggcccacctgggcacc
gcgtccctcgcgggcgtcggcgggagcccggtgaagatggggctcaagagggcggtgctg
cacccccagtacgaccccggcctcctggacttcgacgtggccgtgctggagctggcgggg
cccctggtcttcaacaagtacgtgcagcccgtctgcctgccgctggccgtccagaagttc
cccgtgggccgcaagtgcatgatctccggctgggggaacacgcaggaggggacagcgtcc
aagcctgacatcctgcagcgcgcgtcggtgggcatcatagaccagaaggcgtgcagcgca
ctgtacaacttctcgctcaccgaccggatgctgtgcgccggcttcctggagggccaggtg
gactcctgccagggcgactcggggggccccctggcctgcgaggagacccccggtgtgttt
tacctggcgggcatcgtgagctggggcatcggctgtgcccaggccaagaagcccggcgtg
tactcgcgcatcaccaggctgaagggctggatcctggacaccatgtcctcgcagcccctc
cccgcgccacccccagccaccacgaggacgcccgccaccaccagtcaggcccccaggacg
acggctggcctcacagctccgggggtcacggccagcagacccacccccctggccaccagc
ggggcgaccagccaccctgccaacaggactgccaccgccatggggaccaccaccaggggg
cagatgccgcttccacaagccccggagaccaccctggggccccagccaccaggggtgggg
gccccacggtgcagggcgggcgcgcggctccagcggcccgtctcccccgcaggctcgatg
gcgcggcagcttcagaaggcggccgtgcgccccctgagcgagcagacgtgtcgccgcttc
tacccggtgcagatcagcagccgcatgctgtgcgcgggcttcccgcagggcggcgtggac
agctgctcgggtgacgctgggggcccccttgcctgcagggagccctccggccggtgggtg
ctaactggggtcaccagctggggttacggctgcgggcggccccacttcccgggcgtctat
acccgggtggctgccgtgagaggctggatcgggcagaacatccaggagtga

DBGET integrated database retrieval system