KEGG   Equus asinus (ass): 106834719Help
Entry
106834719         CDS       T04645                                 

Gene name
METAP1D
Definition
(RefSeq) methionyl aminopeptidase type 1D, mitochondrial
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
eai  Equus asinus (ass)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eai01002]
    106834719 (METAP1D)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     106834719 (METAP1D)
Peptidases [BR:eai01002]
 Metallo Peptidases
  Family M24
   106834719 (METAP1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 106834719
NCBI-ProteinID: XP_014702066
LinkDB All DBs
Position
Un
AA seq 335 aa AA seqDB search
MAAPSGVHRLVLRGCHRILSLPLNHIYLHKQSSSQQRRNFFFRRQREISHSIVLPAAVSS
AHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLRQACQLARHVLLLAGKSLKVDMT
TEEIDALVHQEIISHDAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVT
VYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQ
NGLQVCPHFVGHGIGSYFHGHPEIWHHANDSDLLMEEGMAFTIEPIITEGSPEFKVLEDA
WTAVSLDNQRSAQFEHTILITSGGAQILTQLPHEA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccagcggcgtccaccggctcgtcctcagaggttgtcatagaattttgtct
ttaccactcaatcatatctacttacacaagcagtcaagcagtcaacaaagaagaaatttc
tttttccgaagacaaagagagatttcacacagtatagttttgccggctgcagtttcttca
gctcatccagtccctaagcacataaagaagccagactatgtgacgacaggcattgtaccc
gactggggagacagcatagaagttaagaatgaagatcagattcaagggcttcgtcaggct
tgtcagctggcccgtcatgtcctcctcctggctgggaagagcttgaaggttgacatgaca
actgaagagatagatgctcttgttcatcaggaaatcatcagtcatgatgcctatccttca
cctctaggctatggaggttttccaaaatctgtttgtacctctgtaaacaatgtgctatgt
catggtattcctgacagtcgacctcttcaggatggagatattatcaacattgatgtcacg
gtctattacaatggctaccatggagacacctctgaaacatttttggtgggcaatgtggat
gaatgtggtaaaaaattggtggaggttgccaggaggtgtagagatgaagcaattgcagct
tgcagagcaggggctcccttctctgtaattggaaacacaatcagccacataactcatcag
aatggtttgcaagtctgtccacattttgtgggacatgggataggatcttactttcatgga
catccagaaatttggcatcatgcgaatgacagcgatctactcatggaggagggaatggca
ttcaccatagagccaatcataaccgagggatcccctgaattcaaggtcctggaggatgca
tggaccgcggtctctctggacaatcaaaggtccgcccagttcgagcacacaattctcatc
acgtcggggggcgcgcagatcctgacccaactgccccacgaggcctga

DBGET integrated database retrieval system