KEGG   Equus asinus (ass): 106834998Help
Entry
106834998         CDS       T04645                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
eai  Equus asinus (ass)
Pathway
eai00040  Pentose and glucuronate interconversions
eai00051  Fructose and mannose metabolism
eai01100  Metabolic pathways
Module
eai_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    106834998 (SORD)
   00051 Fructose and mannose metabolism
    106834998 (SORD)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     106834998 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2 UDPG_MGDP_dh_N Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 106834998
NCBI-ProteinID: XP_014702543
LinkDB All DBs
Position
Un
AA seq 364 aa AA seqDB search
MPPFPSLPASCGILKKVACLLQRGESGAKENYLIPEPGPNEVLLKMHSVGICGSDVHYWE
HGRIGHFVVKKPMVLGHEASATVVKVGSLVQHLKPGDRVAIEPGAPRETDEFCKIGRYNL
SPSIFFCATPPDDGNLCRFYKHNASFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLG
NKVFVCGAGPIGLVTLLVAKAMGAAQVVVTDLSASRLSKAKELGADFILQISKESPQEIA
SKVEDLLGCKPEVTIECTGAEAAIQAGIYATRSGGTLVLVGLGSEMTTVPLVHAATREVD
IKGVFRYCNTWPMAISMLASKSVNVKPLVTHRFPLEKALEAFETSKKGLGLKVMLKCDPD
DQNP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccttcccctcacttcccgcctcatgtgggatcttgaagaaggtggcatgtctt
ctgcagagaggggagagcggagccaaggagaactatcttatccctgaaccaggccccaat
gaggtgctgctgaagatgcattccgttggaatctgcggctcagatgtccactactgggag
catggtcgaattgggcattttgttgtgaaaaagccaatggtgctggggcatgaagcttca
gcgacagtcgtgaaagtgggatcattggtacagcacctaaagccaggtgatcgtgttgcc
attgagcctggtgctccccgagagactgatgaattctgcaagattggccgatacaatctg
tcgccgtccatcttcttctgtgccacaccccccgatgacgggaacctctgccggttctat
aagcacaatgccagcttctgctacaagcttcctgacaatgtcacctttgaggaaggggcc
ctgattgagccgctgtctgtgggaatccacgcctgccggcgaggtggagtcaccctggga
aacaaagtctttgtgtgtggagctgggccgatcggactagtcactttactcgtggccaag
gcaatgggtgcggctcaagtggtggtgactgatctgtctgcctctcggttgtctaaagcc
aaagaactcggggctgatttcatcctccagatctccaaggagagccctcaggaaattgcc
agtaaagtggaagatctactggggtgcaagccagaagtcaccattgagtgcacgggggca
gaggccgccatccaggccggcatctatgccactcgttctggtgggaccctggtacttgtg
gggctgggctctgagatgaccactgtgcccctagtgcacgcagccaccagggaggtggat
atcaagggcgtgtttcgatactgcaacacgtggccgatggcgatttccatgcttgcgtcc
aagtctgtgaatgtaaagcccttagtcacccataggtttcctctggagaaagctctggag
gcttttgaaacatccaaaaaaggattggggttgaaagtcatgctgaagtgcgaccctgac
gaccagaatccctga

DBGET integrated database retrieval system