KEGG   Equus asinus (ass): 106835278Help
Entry
106835278         CDS       T04645                                 

Gene name
CSAD
Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
eai  Equus asinus (ass)
Pathway
eai00430  Taurine and hypotaurine metabolism
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    106835278 (CSAD)
Enzymes [BR:eai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     106835278 (CSAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase Aminotran_1_2 DUF4910 DegT_DnrJ_EryC1 SepSecS
Motif
Other DBs
NCBI-GeneID: 106835278
NCBI-ProteinID: XP_014702982
LinkDB All DBs
Position
Un
AA seq 493 aa AA seqDB search
MADSEPLLSLDGDPVAAEALLRDVFGIVVDEVIRKGTSASEKVCEWKEPEELKQLLDLEL
RSHGESREQILERCRAVIRYSVKTCHPHFFNQLFSGLDPHALAGRIVTESLNTSQYTYEI
APVFVLMEEEVLKKLRALVGWSSGDGVFCPGGSISNMYAVNLARYQRYPDCKQRGLRALP
PLALFTSKECHYSIKKGAAFLGLGTDSVRVVKADERGKMIPEDLERQISLAKAEGAVPFL
VTATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLAGIQRADSVA
WNPHKLLTAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRV
DCLKLWLMWKAQGGQGLEQRVDQAFALARYLVEELKKREGFELVMEPEFVNVCFWFVPPS
LRGKQGSPDYAERLAKVAPVLKERMVKEGSMMVGYQPHGTRGNFFRMVVANPALTQADMD
FFLNELERLGQDL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctgactctgaaccgctcctctcccttgatggggacccagtggctgcagaagccttg
ctccgggatgtgtttgggatcgttgtggatgaggtcattcggaaagggaccagtgcctcc
gagaaggtctgcgagtggaaggagccggaggagctgaagcagctgctggatttggagctg
cggagccatggggagtcacgggagcagatcctggagcggtgccgggctgtcatccgctac
agcgtgaagacctgtcaccctcacttcttcaaccagctcttctcagggttggatccccac
gctctggccgggcgcattgtcaccgagagccttaacaccagccagtacacttatgaaatc
gcccccgtgtttgtgctcatggaagaagaggtcctgaagaaactccgggcgctggtgggc
tggagctctggcgatggggtcttctgccctggtggctccatctccaacatgtatgctgtg
aacctggcccgctatcagcgctacccggattgcaagcagaggggcctccgggcactgccg
cccctggccctcttcacatcgaaggagtgtcattactccatcaagaagggagctgctttt
ctgggacttggcactgacagtgtccgagtggtcaaggcagatgagagagggaaaatgatc
cctgaggatctggagaggcagatcagtctggccaaggcggagggtgctgtgccattcctg
gtcactgccacctctggcacgaccgtgctgggggcctttgatcccctggaggcgattgct
gatgtgtgccagcgtcatgggctgtggctgcatgtggacgccgcctggggtgggagtgtc
ctgctctcacagacacacagacatctcctggctgggatccagagggcggactccgtggcc
tggaatccccacaagctcctcacagcaggcctgcagtgctcagctctcctgctccgggat
acctcgaacctgctcaagcgctgccacgggtcccaggccagctacctcttccagcaggac
aagttctacgacgtggctctggacacaggagacaaggtggtgcagtgcggccgccgcgtg
gactgtctgaagctgtggctcatgtggaaggcccagggcgggcaagggctggagcagcga
gtggaccaggccttcgcccttgcccggtacctggtggaggaattgaagaagcgggaagga
tttgagttggttatggagcctgagtttgtcaacgtgtgtttctggttcgtcccgcccagc
ctgcgggggaaacaggggagtccagattatgcggaaaggcttgccaaggtggccccggta
cttaaagagcgcatggtgaaggagggctccatgatggttggctaccagccccacgggacc
cggggcaactttttccgcatggttgtggccaacccggctctgacccaggctgatatggac
ttcttcctcaatgagctggaacggctaggccaggacctctga

DBGET integrated database retrieval system