KEGG   Equus asinus (ass): 106835730
Entry
106835730         CDS       T04645                                 

Gene name
AIM2
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
eai  Equus asinus (ass)
Pathway
eai04621  NOD-like receptor signaling pathway
eai04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:eai00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106835730 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    106835730 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN
Other DBs
NCBI-GeneID: 106835730
NCBI-ProteinID: XP_014703791
LinkDB
Position
Un
AA seq 347 aa
MESKYKEILLLTGLDNITDEELDRFKFFLPDELKVSTAKLENANRTEVANLMIQNVGAVS
AVTKTIHVFQKLNYMHVAKSLQEEKEKVDKKYKGKKGTQQVKKRSQTEMSPGASAAPRNS
VVEQHIAPEVSPHVKPKQKQMVAKQEPIRKEGLQKGSMTVMVLKATKPFEFETKEGKQEM
FHATVATESEFFFVKVFNKKLKDKFTPKNIIIISKYYWYSHFLEVNSVSHVSDAKSDQQI
SVPKHIIRKAGETPKINKLQTQPRGTIVNGVFVIQKKTERRNRQLFDLSDSTGRMEVLVP
GKQNKIECEEGDKLRLTFFELSRTGEKLQLKSGIHSLVKVIKAKKLK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagagtaaatataaggaaatcctcttattaactggcctggataacatcactgatgag
gaactggatcgatttaaattcttccttccagatgagttaaaagtctccacagcaaaacta
gaaaatgcaaataggacagaggtagcaaacttgatgattcaaaatgttggtgcagtgtct
gcagtgacgaagaccatacatgttttccagaagctgaattatatgcatgtggcaaaaagt
cttcaggaagagaaggagaaagttgataagaaatacaaagggaaaaaaggaacacagcaa
gtgaaaaagagaagtcaaactgaaatgagtcctggtgcctctgcagctcccagaaatagt
gtcgtggagcaacacattgcaccagaagtctctcctcatgttaagcctaagcagaaacag
atggtggccaagcaggaacctatcaggaaagaagggttgcagaaaggctctatgacagtc
atggtgctgaaagcaacgaagccattcgaatttgagaccaaagaagggaagcaagagatg
tttcacgctacagtggctactgagagtgaattcttttttgtaaaagttttcaacaaaaag
ctaaaggataaattcactccaaagaatataattataatatcaaaatattattggtacagt
catttcctagaagtgaatagtgtctcacatgtgtctgatgccaaatctgaccaacaaatc
agtgtcccaaagcacattatcagaaaagctggtgaaaccccaaagatcaataagcttcaa
actcagccccgtggaacaattgtgaatggggtgtttgtaatccagaagaaaacagaacgg
aggaatcgtcaattatttgacctaagtgacagtacagggaggatggaagtattggtgcct
ggaaaacagaacaaaatcgaatgcgaagaaggggataaacttcgacttacgttctttgag
ctatcaagaactggagaaaaactacagctgaaatctggaattcacagtttagttaaggtt
attaaggcaaaaaaactgaaatga

DBGET integrated database retrieval system