KEGG   Equus asinus (ass): 106835869Help
Entry
106835869         CDS       T04645                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
eai  Equus asinus (ass)
Pathway
eai00020  Citrate cycle (TCA cycle)
eai00190  Oxidative phosphorylation
eai01100  Metabolic pathways
eai01200  Carbon metabolism
eai04714  Thermogenesis
eai04932  Non-alcoholic fatty liver disease (NAFLD)
eai05010  Alzheimer disease
eai05012  Parkinson disease
eai05016  Huntington disease
Module
eai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eai_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106835869 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106835869 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    106835869 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    106835869 (SDHA)
   05012 Parkinson disease
    106835869 (SDHA)
   05016 Huntington disease
    106835869 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    106835869 (SDHA)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106835869 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 106835869
NCBI-ProteinID: XP_014703953
LinkDB All DBs
Position
Un
AA seq 663 aa AA seqDB search
MLGVRVLSRLLPARRLALTRAQWPATLQTRGFHFTVDGTKRASAKVSDSISTQYPVVDHE
FDAVVVGAGGAGLRAAFGLSEAGFDTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRW
HFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKFG
KGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIED
GSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFIQFHPTGIY
GAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEK
DHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQV
LKHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCKPGDKV
PPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKISQ
LYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRI
DEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVKTGKVSLEYRPVIDRTLNEADCATVPPAI
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgttgggggtccgtgtgttgtcgcggctgcttcctgcccggcgtctggcgctgaccagg
gcgcagtggccagcaacattgcagacccgtggttttcacttcactgttgatgggactaag
agggcatctgctaaagtttcagattcaatttctacacagtacccggtggtggatcatgaa
tttgatgcagtggtggtaggtgctggaggggccggcctgcgagctgcgtttggcctctct
gaggcggggtttgacacagcctgtgtgacaaagctctttcccaccaggtcacacactgtc
gcagcccagggaggaatcaatgctgctctggggaacatggaagaggacaactggaggtgg
cacttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatccactac
atgacagagcaggcccccgcctcggtggttgagctggagaattacggcatgccctttagc
agaaccgaagatgggaggatctaccagcgtgcctttggtggacagagcctcaagtttggg
aaaggcgggcaggcccatcggtgctgctgcgtggcagaccgcacaggccactcgctgctg
cacacgttgtatggaaggtctctacgatatgataccagctattttgtagagtattttgcc
ttggatctcctgatggaaaatggggagtgccgtggggttatcgcactatgcatagaagat
gggtccatccatcgcataagagcaaagaacactgttgtagctactggaggctatgggcgc
acctacttcagctgcacgtctgcccacaccagcacaggcgatggcacggccatgatcacc
agggcaggccttccctgccaggacttggagttcattcagttccaccctacaggcatatat
ggtgctggctgtctgatcacggaaggatgccgcggagagggtggcatcctcatcaacagt
cagggcgaaaggttcatggagcggtacgcccccgtcgcaaaggacctggcatccagagat
gttgtgtctcggtccatgactctggaaatccgggagggcagaggctgtggccctgagaag
gatcatgtctacctgcagttgcaccaccttcccccgcagcagctggccacacgcctgcca
ggcatttcagagacggccatgatcttcgcgggtgtggatgtcaccaaggagcccatccct
gtccttcccaccgtgcattataacatgggtggcattcccaccaactacaaggggcaggtt
ctgaagcatgtgaacggccaggatcaggtcgtgcctggcctgtacgcttgtggggaggcc
gcctgtgcctcagtgcatggcgccaaccgtcttggggcaaactcgctcttggacctggtt
gtctttggccgggcgtgtgccctgagtattgcagagtcctgcaaacctggagataaagtt
cccccgattaaaccaaatgctggggaagaatctgtcatgaatcttgacaaactgaggttt
gctgatggcagtataagaacgtcggaactgcgactcagcatgcagaagtcgatgcaaagt
catgctgcagtgttccgtgtgggaagcgtgttacaggaaggctgtgagaaaattagccag
ctctacggagaccttaagcatctgaagacgtttgacagaggaatggtctggaatactgac
ctggtggagaccctggagctgcagaacctgatgctttgcgcgcttcagacgatttatgga
gcagaggcccggaaggagtcacgtggtgctcacgccagggaagattacaaggtgcggatt
gatgagtatgattactccaagcccatccaggggcagcagaagaagccatttgaggagcac
tggaggaagcatactctttcctatgtcgatgtcaagaccgggaaggtctcgctggaatac
agacccgtaatcgacaggactttaaacgaggctgactgcgccacagtgcccccggccatt
cgctcctactga

DBGET integrated database retrieval system