KEGG   Equus asinus (ass): 106836975
Entry
106836975         CDS       T04645                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
eai  Equus asinus (ass)
Pathway
eai04010  MAPK signaling pathway
eai04014  Ras signaling pathway
eai04015  Rap1 signaling pathway
eai04151  PI3K-Akt signaling pathway
eai04390  Hippo signaling pathway
eai04810  Regulation of actin cytoskeleton
eai05200  Pathways in cancer
eai05218  Melanoma
eai05224  Breast cancer
eai05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106836975 (FGF1)
   04014 Ras signaling pathway
    106836975 (FGF1)
   04015 Rap1 signaling pathway
    106836975 (FGF1)
   04390 Hippo signaling pathway
    106836975 (FGF1)
   04151 PI3K-Akt signaling pathway
    106836975 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106836975 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106836975 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    106836975 (FGF1)
   05218 Melanoma
    106836975 (FGF1)
   05224 Breast cancer
    106836975 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:eai04052]
    106836975 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:eai00536]
    106836975 (FGF1)
Cytokines and growth factors [BR:eai04052]
 Growth factors
  Growth factors (RTK binding)
   106836975 (FGF1)
Glycosaminoglycan binding proteins [BR:eai00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   106836975 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 106836975
NCBI-ProteinID: XP_014705754
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaatcacaaccttcacggccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaatgggggccacttcctgaggatc
cttccagatggcacagtggatggaacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttgtacggctcacagacaccaaacgaggaatgtttgttc
ctggaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcagagaag
aactggttcgttggtctcaagaagaatgggagctgcaaacgcggtcctcggactcactat
gggcagaaagcaatcttgtttcttcccctgcccgtctcctctgactaa

DBGET integrated database retrieval system