KEGG   Equus asinus (ass): 106837656Help
Entry
106837656         CDS       T04645                                 

Gene name
CASP1
Definition
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
eai  Equus asinus (ass)
Pathway
eai04217  Necroptosis
eai04621  NOD-like receptor signaling pathway
eai04623  Cytosolic DNA-sensing pathway
eai04625  C-type lectin receptor signaling pathway
eai05014  Amyotrophic lateral sclerosis (ALS)
eai05132  Salmonella infection
eai05133  Pertussis
eai05134  Legionellosis
eai05135  Yersinia infection
eai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:eai00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106837656 (CASP1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106837656 (CASP1)
   04623 Cytosolic DNA-sensing pathway
    106837656 (CASP1)
   04625 C-type lectin receptor signaling pathway
    106837656 (CASP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    106837656 (CASP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106837656 (CASP1)
   05135 Yersinia infection
    106837656 (CASP1)
   05133 Pertussis
    106837656 (CASP1)
   05134 Legionellosis
    106837656 (CASP1)
  09172 Infectious disease: viral
   05164 Influenza A
    106837656 (CASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eai01002]
    106837656 (CASP1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eai04131]
    106837656 (CASP1)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     106837656 (CASP1)
Peptidases and inhibitors [BR:eai01002]
 Cysteine peptidases
  Family C14: caspase family
   106837656 (CASP1)
Membrane trafficking [BR:eai04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    106837656 (CASP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD DDE_Tnp_1_7
Motif
Other DBs
NCBI-GeneID: 106837656
NCBI-ProteinID: XP_014706813
LinkDB All DBs
Position
Un
AA seq 405 aa AA seqDB search
MAGNILKEKRRLFIRSVGTGTVNSLLDELLEKRVLNQEEMEKVRDENATVMDKARALIDA
VIRKGPQACQIFIGHICEDDPHLAETLGLSSGPQSGNFLKTQDSQAVVHSFPALQAMPDD
LAKLALSGPKGSLKLCSPEVVERIWKEKSAEMYPIMGKSMTRTRLALIICNTEFDDLSRR
AGAEVDIASMKVLLEGLGYSVEVKENLTALDMTTELKAFAARPEHRSSDSTFLVFMSHGI
REGICGKKFSEKVPDVLEVNTIFQIFNTRNCPNLRDKPKVIIIQACRGENQGVVWLKDST
GTSGSSSSLAPDDFEDDAIKKAHVEKDFIAFCSSTPDTVSWRSPTTGSVFIEKLIENLQE
YAWSCDLEEIFRKVRLSFELPDARAQMPTAERVTLTRRFYLFPGY
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaacatcctgaaggaaaagaggaggctgtttatccgttcagtgggcacgggt
acagtaaatagcttgctggatgaactgttagagaaaagagtgctgaaccaggaagagatg
gagaaagtaagagatgaaaatgctacagttatggataaggcccgagctttgattgatgct
gtcattcggaaagggccccaggcatgccaaatttttatcggtcacatttgtgaagatgac
ccccaccttgcagagacactgggcctatcctcaggtccacaatctggaaattttcttaaa
acacaagactcccaagcagtggttcattccttcccagctcttcaggcaatgccggatgac
ctggctaagcttgcattgtcagggccaaaagggagcctcaagctttgttcaccagaagtg
gtcgaaaggatatggaaagaaaagtcagcagagatgtacccaataatgggaaagtcgatg
acccgcacacggcttgcgctcattatctgcaacacagagtttgacgatctttccaggaga
gctggagctgaagttgatattgcaagtatgaaggtgctgctagaaggtctgggctacagt
gtggaagtgaaagaaaatctcactgctttggacatgactacagagctgaaggcatttgct
gcccgcccagagcaccggtcctctgacagcactttcctggtgttcatgtctcatggtatt
cgagaaggcatttgtgggaagaaattctctgagaaagtcccagatgtattagaagtcaac
accatctttcaaatttttaacaccaggaactgtccaaatttgagggacaaacccaaggtg
atcattatccaggcctgccgtggtgagaatcaaggggtggtgtggttaaaagactcaaca
ggaacttctggaagtagctcctcactggctccagacgattttgaggatgatgccattaag
aaagcccatgtagagaaagattttattgctttctgctcttcaacaccagatactgtttct
tggcgaagtcccacaacgggctctgttttcattgagaaactcattgaaaatttgcaagaa
tatgcctggtcctgtgatctggaggaaattttccgaaaggtccgattatcatttgagttg
ccagatgctagggcacagatgcccaccgccgaaagggtgactttgacaagacgcttctac
ctctttccaggatattaa

DBGET integrated database retrieval system