KEGG   Equus asinus (ass): 106838232Help
Entry
106838232         CDS       T04645                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
eai  Equus asinus (ass)
Pathway
eai03030  DNA replication
eai03410  Base excision repair
eai03420  Nucleotide excision repair
eai03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:eai00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106838232 (LIG1)
   03410 Base excision repair
    106838232 (LIG1)
   03420 Nucleotide excision repair
    106838232 (LIG1)
   03430 Mismatch repair
    106838232 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eai03032]
    106838232 (LIG1)
   03400 DNA repair and recombination proteins [BR:eai03400]
    106838232 (LIG1)
Enzymes [BR:eai01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106838232 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     106838232 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106838232 (LIG1)
DNA replication proteins [BR:eai03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106838232 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106838232 (LIG1)
DNA repair and recombination proteins [BR:eai03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106838232 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     106838232 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     106838232 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 106838232
NCBI-ProteinID: XP_014707669
LinkDB All DBs
Position
Un
AA seq 911 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNGIRETEPPPKVALKERNGVVPEGDSPVKRPGRKA
ARVLGSEGEEEDEALTSPKDQKPAPDSPKVSPPSPESTPALCSASPARVSLSGIPKRRTA
RKQLPKRAIQDVLEDQSEDEDREAKRKKEEDEAETPTESLTEPEVAKRKEVEEKDRPTTP
PELPENSTEAPTDSVAEPEGAVKQEPQEDQPQPPPRAPKTLSSFFAPRKPAVKKEVKEEE
GSGAPRKEETKGPLDPPSYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIEEVSARLR
MVETLSNLLRSVVALSPPDLLPILYLSLNRLGPPQQGLELGIGDGILLKAVAQATGRQLE
SVRAEAAEKGDVGLVAESSRSTQRLMLPPPALTASGVFTKFQDIARLAGSASTTKKMDVI
KGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPPAVVDAGKGK
TPEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGLERLPEHCRLSPGVPLKPMLAHP
TRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDVISRIPK
IKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDLIYLNG
ESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTDQIAEFLEQSVKDSCEGLMVKTL
DVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLACYDEES
EELQAICKLGTGFSDEELEEHHQSLQALVLPSPRPYVRADGAVAPDHWLDPSAVWEVKCA
DLSLSPIYPAARGMVSGWRXSLRFPRFIRVREDKKPEEATTSAQVAHLYWKQSQIQNQQG
TDVDSDPEDFY
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccaccccaagaaagagggcaaagcaaagaagcca
gagaaggaagcgtccaacggcatcagagagacggaaccccctccaaaggtggcgctgaag
gagcggaatggagtggtgcccgagggcgactctccagtgaagaggccagggaggaaggca
gcccgggtcctgggcagcgaaggggaggaggaggacgaggccctcacgtcccccaaagac
cagaagcctgccccggactctccgaaagtctcccctcccagtcccgagagcacccctgcc
ctctgcagcgcctctcctgcacgcgtctccctgtcagggatcccgaagcgccgcacagct
cggaagcagcttcctaaacgggcgattcaggatgtcctggaagatcagagcgaggacgag
gacagggaagccaagaggaagaaggaggaagacgaagcagagaccccgacagaaagcctc
acagagcctgaagtggccaaaaggaaggaagtagaagagaaggaccggcccacgacgccc
ccagagctcccagagaactccacagaggccccgacggacagcgttgccgagcctgagggg
gccgtgaagcaggagccgcaggaggaccagcctcagcctcctcccagagcccccaagacg
ctcagcagcttcttcgccccccggaagcctgcagtcaaaaaagaagtgaaagaagaggag
gggtccggtgccccgagaaaggaggagaccaagggacccctggaccctcccagctacaat
cctgccaagaacaactaccatcccgttgaagacgcctgctggaagccgggccagaaggtc
ccttatctggcggtggcccggacgttcgagaagatcgaggaggtttctgcgcggctccgg
atggtggagacgctgagcaacttgctgcgctccgtggtggccctgtcacccccagacctg
ctccccatcctctacctcagcctcaaccgccttgggccaccccagcagggcctggagctt
ggcatcggggacggcatccttctcaaggccgtggcgcaggccacaggtcggcagcttgag
tctgtccgggctgaggctgccgagaagggcgacgtggggctggtggccgagagcagccgc
agcacgcagaggctcatgcttcccccgcctgccctcaccgcctctggggtcttcaccaag
ttccaggacatcgcccggctcgctggcagtgcttccacaaccaagaagatggatgtcatc
aaaggcctctttgttgcctgccgccactcagaagcccggttcatcgccagggccctgagt
ggacggctgcgcctcgggctggcagagcagtcggtgttggccgccctggcccaggccgtg
agcctcacacccccaggccaagaattccccccggccgtggtggatgctgggaagggcaag
acaccagaggccagaaaaacatggctggaggagcaaggcatgatcctgaagcagacgttc
tgtgaggtgcctgacctggaccggatcgtccccgtgctgctggagcatggcctggaacgc
ctcccggagcactgcaggctgagcccaggggtccccctgaaaccaatgttggcacacccc
acccggggcgtcagtgaggtcctgaaacgcttcgaggaggcagccttcacctgcgagtac
aaatacgatgggcagagggcgcagatccatgtcctggaaggcggggaggtgaaaatcttc
agcaggaatcaggaggacaataccggaaagtaccccgacgtcatcagccgcatccccaag
attaaactcccgtcagtcacgtccttcatcctggacactgaagccgtggcctgggaccgg
gaaaagaagcagatccagccattccaagtgcttaccacccgcaagcgcaaggaggtggac
gctgcggagatacaggtgcaggtgtgtctgtacgccttcgacctcatctacctcaatgga
gagtccctggtgcgggagcccctttcccgacgccggcagctgcttcgggagaacttcgtg
gagacggagggcgagtttgtcttcgccacctccctggacaccaaggacacggaccagatc
gccgagttcctggagcagtcggtgaaagactcctgcgaggggctcatggtaaaaaccctg
gatgtcgacgccacctacgagatcgccaagaggtcacacaactggctcaagctgaagaag
gactacctcgatggcgtgggcgacaccctggacctcgtggtgatcggcgcctacctgggc
cgggggaagcgggccggccgctacgggggcttcctgctggcctgctacgacgaggagagt
gaggagctgcaggccatatgcaagcttggcactggcttcagcgacgaggagctggaggag
catcaccagagcctgcaggccctggtgctgcccagcccgcgcccctacgtccgggcggac
ggcgccgtggcccccgaccactggctggaccccagcgccgtgtgggaggtgaagtgcgct
gacctgtccctctcccccatctaccccgcggcccggggcatggtgagtggctggagganc
tcccttcgcttccctcggtttattcgcgtccgtgaagacaagaagcccgaggaggccacc
accagcgcccaggtggcccatctgtactggaagcaaagtcagattcagaaccagcaaggc
acggacgtggactccgacccggaagatttctactag

DBGET integrated database retrieval system